SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022168 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022168
Domain Number 1 Region: 973-1282
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.28e-90
Family Complement components 0.0000268
Further Details:      
 
Domain Number 2 Region: 1355-1484
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.36e-38
Family Alpha-macroglobulin receptor domain 0.0000012
Further Details:      
 
Domain Number 3 Region: 801-921
Classification Level Classification E-value
Superfamily E set domains 2.24e-35
Family SVA-like 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022168
Domain Number - Region: 369-429
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0345
Family Invasin/intimin cell-adhesion fragments 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022168   Gene: ENSECAG00000024571   Transcript: ENSECAT00000026560
Sequence length 1489
Comment pep:known chromosome:EquCab2:6:36100496:36158639:-1 gene:ENSECAG00000024571 transcript:ENSECAT00000026560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGRYVLPCLVLICIALLPAAASVRGKPQYMVLAPSSLHTETPEKSCLLLRRLNETVTV
SAYLESTKGKRSLFNDLIADKDLFHCVSFTLPRSSSFEDELFFSVQIKGPTHEFSKRTKV
LVKNTESLVFIQTDKQIYTPGQSVKFRIVSVDKNFHPLHELFPLVHIEDPGMNRIMQWQN
IQLENGLKQLSFSLSSEPIKGSYKIVILKQSGIKTEHSFTVEEFVLPKFEVQVKVPKVIT
VLDEEVNVTVCGIYTYGKPVPGHVTMSICRKYHYSFYRFGRNLEVPCEEVSQKLDSHGCI
MQQVKTSVFQLKEQNFQTMKLQVNAKITEEGTGLELTGTGTIEVTRTLTKLTFVKVDSHF
RRGIPFFGQVCLVDGKGVPIPDELISIQANEANYSSNATTDEHGLVQFSIDTTNVTDSSL
TVSVYHKEQSPCFSYYYCMTEKHKQAYHTANHVFSLSKSYVYLEAVAGPLPCGQIHTIQA
HYILNGQVLGELKELVFYYLIMAKGSIIRTGVHILPLEPGKRELRGHFSMSVPVESDIAP
IAQLLLYAILPDGEVFGDFAKYEVENCLPNKVDLSFHPTQSLPASHTHLRVTASPQSLCA
LRAVDQSVLLMKPEAELSPASVYNLLPAKDFADFIHSSNQQKEDQKDCIKRDNVSIDGLM
YSSVSHSNEEDVYSFMRSMDLKVFTNLKIKHPKFCPDDIIHQPPGYIKTFLSPRFSCLFI
SENKSTQPSNMPQKLEPPEDPFTETVRNYFPETWIWDLVVVNSSGVAEVGATVPDTITEW
KAGALCLSSGAGLGLSPTASLQAFQPFFLELTMPYSVIRGEAFTLKATVLNYLPKCIRVS
VQLEASLDFMAIPVEKDQDSYCLCSNGRQTVSWLVTPKSLGNVNFSVSAETLQSSELCGN
EVAVVPEIGRKDTVVKLLLVEPEGIKKEYAFNSLLCASDVGVSEKLSLKLPSKVVEESAR
ASFSVLGDILGSAIKNTQNLLQMPYGCGEQNMVLFAPNIYVLKYLNETHQLTQEIKSKAI
GYLNAGYQRQLNYKHRDGSYSAFGDQHGKKKGNTWLTAFVLKSLAQARAFIFIDETHITQ
ALTWLSNKQKNDGCFKSSGSLLNNAIKGGVEDEVTLSTYITIALLEIPLPVTHPVVHNAL
LCLESAWKTTQEEAHGSHVYTKALLAYAFALAGDQDKRREILKSLEEEAIKEHNATHWER
PQKPKASVEHLYEPQAPSAEVEMTSYVLLAYLTAQPTPTSEDLTSATHIVKWITKQQNSQ
GGFSSTQDTVVALHALSIYGAATFAGTGEAALVTIQSSGTFSTKFQVENTNRLLLQQVSL
PDIPGEYSINVSGEGCVYIQAALKYNVFLEKKESAFALQVQTIPQICDGLKVHTSFQVSL
EVSYTGSRPVSNMVIADVKMISGFIPLKPTVKMLELSSHVSRTEVSNNNVLIYVEQVTSQ
TLSFSFTVVQDIPVRDLKPAIVKVYDYYETDEAAFAEYSAPCHTGKQFA
Download sequence
Identical sequences F6R7S3
ENSECAP00000022168 9796.ENSECAP00000022168 ENSECAP00000022168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]