SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022199 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022199
Domain Number 1 Region: 1004-1341
Classification Level Classification E-value
Superfamily NHL repeat 1.31e-24
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 699-774
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000155
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022199
Domain Number - Region: 540-565
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000318
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 443-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000385
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 1309-1331,1358-1476
Classification Level Classification E-value
Superfamily YWTD domain 0.000575
Family YWTD domain 0.043
Further Details:      
 
Domain Number - Region: 510-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 376-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 411-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 577-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00816
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 346-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0368
Family EGF-type module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022199   Gene: ENSECAG00000024454   Transcript: ENSECAT00000026593
Sequence length 2541
Comment pep:known chromosome:EquCab2:14:12643437:13101824:-1 gene:ENSECAG00000024454 transcript:ENSECAT00000026593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLGPPNHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLA
TTPESVQLQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLP
RNTFSRKAFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHT
FNNGIRTGLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHI
SQPQFLKFNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTL
VQNEAVFVQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGLCHC
FPGFLGADCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCID
GNCVCSAGYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGH
GTYLPDTGLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPR
CIEHGTCKDGKCECREGWNGEHCTIELQGTGWEENGCPDLCNGNGRCTLGQNSWQCVCQT
GWRGPGCNVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQ
TDSPAVKSFYDRIKLLAGKDSTHIIPGDNPFNSSLVSLIRGQVVTTDGTPLVGVNVSFAK
YPKYGYTITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEE
NSIPSCDLSGFVRPDPIIISSPLSTFFTAAPAQNPIVPETQVLHEEIELPGSNVKLRYLS
SRTAGYKSLLKITMTQSTVPLNLIKVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYG
QRVYGLSDAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGI
LHKGTGENQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLFV
GDFNYIRRIFPSRNVTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRV
KSLSGAKDLAGNSEVVAGTGEQCLPFDEARCGDGGKAVDATLMSPRGIAVDKNGLMYFVD
ATMIRKVDQNGIISTLLGSNDLTAVRPLSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLE
NNVILRITENHQVSIIAGRPMHCQVPGIDYSLSKLAIHSALESASAIAISHTGVLYITET
DEKKINRLRQVTTNGEICLLAGAASDCDCKNDVNCNCYSGDDAYATDAILNSPSSLAVAP
DGTIYIADLGNIRIRAVSKNKPVLNAFNQYEAASPGEQELYVFNADGIHQYTVSLVTGEY
LYNFTYSADNDVTELIDNNGNSLKIRRDSSGMPRHLLMPDNQIITLTVGTNGGLKVVSAQ
NLELGLMTYDGNTGLLATKSDETGWTTFYDYDHEGRLTNVTRPTGVVTSLHREMEKSITI
DIENSNRDDDVTVITNLSSVEASYTVVQDQVRNSYQLCNNGTLRVMYANGMGVSFHSEPH
VLAGTITPTIGRCNISLPMENGLNSIEWRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDR
NIRTEKIYDDHRKFTLRIIYDQVGRPFLWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERT
DIDKQGRIVSRMFADGKVWSYSYLDKSMVLLLQSQRQYIFEYDSSERLHAVTMPSVARHS
MSTHTSIGYIRNIYNPPESNASVIFDYSDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVY
DSTAVTFGYDETTGVLKMVNLQSGGFSCTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTY
HDNSFRIASIKPVISETPLPVDLYRYDEISGKVEHFGKFGVIYYDINQIITTAVMTLSKH
FDTHGRIKEVQYEMFRSLMYWMTVQYDSMGRVIKRELKLGPYANTTKYTYDYDGDGQLQS
VAVNDRPTWRYSYDLNGNLHLLNPGNSVRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQR
GADIFEYNSKGLLTRAYNKASGWSVQYRYDGVGRRASYKTNLGHHLQYFYSDLHNPTRIT
HVYNHSNSEITSLYYDLQGHLFAMESSSGEEYYVASDNTGTPLAVFSINGLMIKQLQYTA
YGEIYYDSNPDFQMVIGFHGGLYDPLTKLVHFTQRDYDVLAGRWTSPDYTVWKNVGKEPA
PFNLYMFKSNNPLSNELDLKNYVTDVKSWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSE
SQASENGQLITGVQQTTERHNQAFMALEGQVISKKLHATIREKAGHWFATTTPIIGKGIM
FAIKEGRVTTGVSSIASEDSRKVASVLNNAYYLDKMHYSIEGKDTHYFVKIGSADSDLVT
LGTTIGRKVLENGVNVTVSQPTLLVNGRTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKA
RVLDQARQRALGTAWAKEQQKARDGREGSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQY
PELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences F6Q9D1
ENSECAP00000022199 ENSECAP00000022199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]