SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022244 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022244
Domain Number 1 Region: 100-491
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.57e-31
Family Soluble quinoprotein glucose dehydrogenase 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022244
Domain Number - Region: 586-625
Classification Level Classification E-value
Superfamily SRCR-like 0.0114
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022244   Gene: ENSECAG00000024687   Transcript: ENSECAT00000026640
Sequence length 625
Comment pep:known chromosome:EquCab2:24:41688117:41705328:1 gene:ENSECAG00000024687 transcript:ENSECAT00000026640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QECSPYAAHLYDAEDPSTPLRTLPGLCEDYCLDMWQTCRGLIRHLSPDRELWALEDNRAK
FCHYLSLDDTDYCFPRLLVNENLNSNLGRVVADAKGCLQLCLEEVANGLRNPVAMVHAHD
GTHRFFVAEQVGLVWAYLPDRSRLEKPFLNVSQAVLTSPWEGDERGFLGIALHPGFRHNG
KLYVYYSVGVDFDEWIRISEFRVSEDDMNTVDHRSERIILEIEEPASNHNGGQLLFGDDG
YLYIFTGDGGMAGDPFGKFGNAQNKSALLGKVLRIDVDRNERGPLYRIPPDNPFVGDPAA
RPEVYALGVRNMWRCSFDRGDPASGAGRGRLFCGDVGQNKFEEVDLVERGRNYGWRAREF
ECYDRKLCNNASSRYDVLPIFAYPHKLGKSVTGGYVYRGCEYPNLNGLYIFGDFMSGRLM
SLRENPGTGQWRYSEICMGRGQTCEFPGLINNYYPYIISFAEDEAGELYFMSTGVPSATV
ARGVVYKVIDPSRRAPPGKCRIQPTQVKVRSRLVRFVPKEKFIRRTESTPRPTARAPTNA
PRRSRPTAAPPAPTPRPARPTRRPEGRRAGGRRRGSAGHSPALSNGAVRLVRPAALSPRG
RVEVFSGRLGTVCDDADTKAAAVVC
Download sequence
Identical sequences F6SQN2
ENSECAP00000022244 ENSECAP00000022244 9796.ENSECAP00000022244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]