SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022378 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022378
Domain Number 1 Region: 719-976
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-75
Family Protein kinases, catalytic subunit 0.0000000176
Further Details:      
 
Domain Number 2 Region: 2-149
Classification Level Classification E-value
Superfamily Sema domain 8.76e-24
Family Sema domain 0.0023
Further Details:      
 
Domain Number 3 Region: 308-396
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000802
Family Other IPT/TIG domains 0.062
Further Details:      
 
Domain Number 4 Region: 149-195
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000366
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 395-488
Classification Level Classification E-value
Superfamily E set domains 0.000000000146
Family Other IPT/TIG domains 0.061
Further Details:      
 
Domain Number 6 Region: 193-251
Classification Level Classification E-value
Superfamily E set domains 0.0000000731
Family Other IPT/TIG domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022378   Gene: ENSECAG00000024812   Transcript: ENSECAT00000026782
Sequence length 1034
Comment pep:known chromosome:EquCab2:16:37279526:37291811:1 gene:ENSECAG00000024812 transcript:ENSECAT00000026782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLIDQGVERCCESSVHPGLRRGLDFFQLPSLCPNPPGLEAPSPNASCYHFPLLVSGSL
LRVDLFNGLLGPVQVTALHVTRLDNVTVAHMGTADGRILQVELARSFNFLLYVSNFSLGS
NGQPIQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCWRCLRAQRFMGCGWCGGMCG
RQKECPGSWQQDYCPPELTEFYPHSGPLRGSTRLTLCGSNFYLYPAGLVPEGTHLVTVGE
SPCQVLPKDSSNLSPVPRKDFVEELECELKPLSTQAAGPANISLTVTNMPRGKHFWVDGT
SMLQGFSFLEPVLRAVQPLFGPKAGGTCLTLKGQDLSAGTSQAVLVNGTECLLKQVTEGQ
LLCITPPGAAVASVPIQLQVGGAEVPGSWTFHYQEDPVILSISPNCGYTGSRVTIHGQHL
TSVWHLVLSFQDGLRAVENRCEGQLPEQHWCRLPEYVVRGPQGWVTGNLSAWGDGAPAFT
LPGFRFLPPPHPPSTKLAPLKPEEHAIKFEYIGLGSVADCVDVNVTVGGESCQHELRGDV
VICPLPPSLQLGKDGTPLQVCVNGECHILGRVVQQARQRFPQRTLLGVLLALLLLVAVLA
TALVFNYRRKKQLVLSPNLDNLASLNRTTGAVSLPMLHSGSDCRNGLVPYSLSFTAAPAI
DGLDSTTRVHRASFSDSRDGSCIPLLQTESIQLGDLDSSLLAEVKDVLIPHEHVVTHSNQ
VIGKGHFGVVYHGEYTDKAQNRIHCAVKSLSRITEVQEVEAFLREGLLMRGLHHPNVLAL
IGIVLPPEGLPCVLLPFMRHGDLLRFIRSPQRNPTVKDLISFGLQVAHGMEYLAEQKFVH
RDLAARNCMLDESFTVKVADFGLARYVLDKEYYSIRQHRHARLPVKWMALESLQTYKFTT
KSDVWSFGVLLWELLTRGAPPYPNIDPFDLTHFLAQGRRLPQPEYCPSSLYAVMERCWAE
DPAARPTFRMLTGEVERVVAALYGDHYVQLPTAYVNLGPGALNEVNMPLEQSPSPPMWRS
MGQSRPLSEPPSPT
Download sequence
Identical sequences F6QXR4
ENSECAP00000022378 ENSECAP00000022378 9796.ENSECAP00000022378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]