SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022389 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000022389
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00477
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 801-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 541-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family Laminin-type module 0.038
Further Details:      
 
Domain Number - Region: 148-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family Laminin-type module 0.053
Further Details:      
 
Domain Number - Region: 281-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family Laminin-type module 0.054
Further Details:      
 
Domain Number - Region: 754-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 613-742
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0837
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 715-760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family Laminin-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022389   Gene: ENSECAG00000024752   Transcript: ENSECAT00000026796
Sequence length 1138
Comment pep:known chromosome:EquCab2:14:47193316:47352901:-1 gene:ENSECAG00000024752 transcript:ENSECAT00000026796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVISSNSCLGFICLLLCHWIRTASSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESREMCVPHCADKCVHGRCIA
PNTCQCEPGWGGTNCSSACDGDHWGPHCSSRCQCKNKALCNPITGACHCSAGFRGWRCED
RCEQGTYGNDCHQRCQCQNGATCDHVTGECRCSPGYTGAFCEDLCPPGKHGPQCEQRCPC
QNGGVCHHVTGECSCPSGWLGTVCGQPCPEGRFGKNCSQECQCHNGGTCDAATGQCYCSP
GYTGERCQDECPVGTYGVRCAETCQCVNGGKCYHVSGSCLCEAGFAGEHCEARLCPEGLY
GIKCDKRCPCHLDNTQSCHPMSGECACKPGWSGLYCNETCSPGFYGEACQQICSCQNGDC
DSVTGKCTCAPGFKGIDCSTPCPLGTYGINCSSLCGCKNDAVCSPVDGSCTCKAGWHGVV
CSISCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWHGEKCELPCQDGTYGLNCAER
CDCSHADGCHPTTGHCRCLPGWSGVHCDSVCAEGRWGPNCSLPCYCKNGASCSPDDGICE
CAPGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVCP
SGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPAHWGPNCIHTCNCHNG
AFCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCQNGADCDHISGQCTCRTGFM
GKHCEQKCPAGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLNS
LSRTSTALPADSYQIGAIAGIIILVLVVLFLLALFIIYRHKQKGKESSMPAVTYTPAMRV
MNADYAISETLPHSSSGNANSHYFTNPSYHTLTQCATSPHVNNRDRMTIAKSKNNQLFVN
LKNVNPGKRGPLVDCTGTLPADWKHGGYLNEFGAFGLDRSYMGKSLKDLGKNSEYNSSSC
SLSSSENPYATIKDPPVLIPKNSECGYVEMKSPARRDSPYAEINNSTSANKNVYEVEPTV
SVVQGMFSNNGHLTQDPYDLPKNSHIPCHYDLLPVRDSSSSPKREDGGSSSSSGSSSE
Download sequence
Identical sequences F6QX70
ENSECAP00000022389 ENSECAP00000022389 9796.ENSECAP00000022389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]