SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022393 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022393
Domain Number 1 Region: 239-476
Classification Level Classification E-value
Superfamily vWA-like 1.7e-30
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022393   Gene: ENSECAG00000024792   Transcript: ENSECAT00000026800
Sequence length 909
Comment pep:known chromosome:EquCab2:16:34978156:34991796:-1 gene:ENSECAG00000024792 transcript:ENSECAT00000026800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMDGTMGLRGLLCMYVVPLLALQAMPAQGSPTDRPKGSEKRQAVNTAVDGVIIRNLKVNC
KVTSRFAHCVITSQVVNSADEAKEVAFDVEIPKTAFISDFAITADGQAFVGDIKDKVTAW
KQYRKAAISGENAGLVRASGRTMEQFSINLIVGPRSKATFRLTYEEVLKRKLTQYDLVIK
VKPKQLVDHFEIDVDIFEPQGISKLDAQASFLPKQLATQIIKKSFSGKKGHVLFRPTVGQ
QQSCPTCSTSLLNGDFRVTYDVNRDKPCDLLVTNNHFAHFFAPQNLTNLNKNLVFVIDIS
TSMQGQKVQQTKEALLKILGDMRPGDYFDLVLFGSGVQSWKGSLVPASAANLQAARDFVQ
RFTLEGSTNLNGGLLQGIEILNKAQGSLPEVSNHASILIMLTDGEPTEGVTDRSQILKNV
RNAIRGKFPLYNLGFGQNVDFNFLEVMSMENNGRAQRIYEDHDATQQLQGFYDQVATPLL
VDVELQYPQDAVSALTQHRHKQYYEGSEIVVAGRVADHKLSSFKADVQAHGEGQEFKTTC
LVDEEEMKKLLQERGHMLENHIERLWAYLTIQELLAKRMKLEGEEKANLTAKALQMSLAY
QFVTPLTSMTIRGMEDKDGLKPIIDKPPEDSQPLEMLGHRKTFMLSASQPSPTRPSSNVM
QLPSQVTGVDTDPHFIIHVPQKEDTLCFNINEEPGVVLSLVQDPDTGFSVNGQLIGNNAR
SPGQHEGTYFGRLGIANPATGFQLEVTPQNIMLNPRSGGPVFSWRDQALLRQDEVVVAIN
RKKSLVVSVEDRGTFEVVLHRVWKGSHQDFLGFYVLDSHQMSRRTHGLLGQFFHPFDYKV
SDLHPGSDPTKTDATMVVKNHRLTVTRGSQKDYSKDPRHGAEVTCWFVHNNGAGLIDGIH
TDYIVPDIF
Download sequence
Identical sequences F6QX36
ENSECAP00000022393 ENSECAP00000022393 9796.ENSECAP00000022393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]