SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022461 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022461
Domain Number 1 Region: 214-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022461
Domain Number - Region: 152-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000235
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 119-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00174
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 183-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 248-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00652
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022461   Gene: ENSECAG00000024904   Transcript: ENSECAT00000026872
Sequence length 317
Comment pep:known chromosome:EquCab2:6:80736409:80798418:-1 gene:ENSECAG00000024904 transcript:ENSECAT00000026872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVP
LLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQAEC
PGGCRNGGLCNERRVCDCPDGFYGPHCEKALCVPRCMNGGLCVTPGFCICPPGFYGVNCD
KANCSTTCSNGGTCFYPGKCICPPGLEGDQCEISKCPQPCRNGGKCIGKSKCKCPKGYQG
DLCSKPVCEPGCGTHGTCHEPNNCQCQEGWHGRHCNKRYGASLGLTPRAAGARLRQHAPA
LKKAEERQNPPESNYIW
Download sequence
Identical sequences F6PJN9
XP_014596521.1.31192 9796.ENSECAP00000022461 ENSECAP00000022461 ENSECAP00000022461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]