SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022518 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022518
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 1.31e-73
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000047
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-19
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022518   Gene: ENSECAG00000024963   Transcript: ENSECAT00000026933
Sequence length 391
Comment pep:known chromosome:EquCab2:7:37470386:37473936:-1 gene:ENSECAG00000024963 transcript:ENSECAT00000026933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASGQNMFRMLNRVLTERMFKHLRKWFVTCFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFLFGLLWYAVAYIHKDLPEFHPSVNHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEKCGTAIFLLIFQSILGVIVNSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHTSPFFHMAAETLPQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDATARMKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences F6S9A7
ENSECAP00000022518 ENSECAP00000022518 XP_001502613.2.31192 XP_008519120.1.77740 9796.ENSECAP00000022518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]