SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022576 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022576
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 1.91e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000401
Further Details:      
 
Domain Number 2 Region: 68-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.97e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022576   Gene: ENSECAG00000025007   Transcript: ENSECAT00000026994
Sequence length 419
Comment pep:known chromosome:EquCab2:7:37520027:37545283:1 gene:ENSECAG00000025007 transcript:ENSECAT00000026994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKC
NVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTITWLFFGFIWWLIAYIRGDLDH
VGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLDQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETYTP
SCCAKELAEMKREGRLLQYLPSSPLPGGCAKAELAAEAEQDGEDESEGLSGSREIRGSM
Download sequence
Identical sequences F6RSN5
9796.ENSECAP00000022576 ENSECAP00000022576 XP_014596874.1.31192 ENSECAP00000022576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]