SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022632 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022632
Domain Number 1 Region: 146-735
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.65e-184
Family Myeloperoxidase-like 0.000000000116
Further Details:      
 
Domain Number 2 Region: 742-801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000598
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 794-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000298
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022632   Gene: ENSECAG00000025046   Transcript: ENSECAT00000027054
Sequence length 874
Comment pep:known chromosome:EquCab2:15:90237053:90291695:-1 gene:ENSECAG00000025046 transcript:ENSECAT00000027054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALVVLGATLAVACAGVLFPFILRGKDLLWGKTEDSHVIRILEESRLVVDNAIYNTMKR
NLNKREIISPSQLLSFSKLPEPTSRAVSRAAEIMETSVQVMRRRGYLNLKQAQPPTDALS
EDLLNVIANMSGCLPHMLPPKCPRTCLADRYRLITGACNNRDHPRWGASNTALARWLPPA
YEDGISEPRGWNPHFLYNGFPLPSVREVTRQVIQVSNEAVTEDDQYSDLLTAWGQYIDHD
IAFTPQSTSRAAFRGGADCQLTCETRSPCFPIQLPAADASLTAGPACLPFYRSSAACGTG
TQGALFGNVSSAHPRQQMNGLTSFLDASTVYGSSPASEKLLRNWTSAEGLLRVNTRHQDA
GRAYLPFVPPPTPSACAPEPGADPAARAPCFLAGDGRASEIPSLAAVHTLWLREHNRVAA
ALKASTRTAPTPAYQDAPTVAGRLHQIIITMRDYVPRILGPEAFGRLVGPYEGYDPAVDP
TVSNVFSTAAFRFGHATVHPLVRRLDARFQEHPALPRLPLHDAFFRPWRLLWEGGLDPVV
RGLLARPAKLQVQDQLMNQELTERLFVLANSGTLDLASLNLQRGRDHGLPGYNEWREFCG
LPRLETRADLNTAIANRSIADRIMDLYKHPDNIDVWLGGLAENFLPKARTGPLFACIIGK
QMKALRDGDRFWWENSHVFTEAQRRELARHSLSRVICDNTGLTRVPAEAFRVGTFPQDFE
SCEDIPGMDLAVWREALPQDGTCGSPEGVENGDFVLCEESGKRVLVFSCRHGFELQGQEQ
ITCTPQGWDFQPPVCKDINECEDMMDPPCHLSARCKNTKGSFQCECTDPYVLGEDGRTCV
DSGRLPKASLVSLALGALLVGCLAGLAWMAICRW
Download sequence
Identical sequences F6QKN1
ENSECAP00000022632 9796.ENSECAP00000022632 ENSECAP00000022632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]