SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022659 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022659
Domain Number 1 Region: 130-318
Classification Level Classification E-value
Superfamily vWA-like 1.53e-60
Family Integrin A (or I) domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 2299-2504
Classification Level Classification E-value
Superfamily vWA-like 2.23e-57
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1175-1378
Classification Level Classification E-value
Superfamily vWA-like 3.89e-57
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 4 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 1.39e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2521-2724
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.7e-34
Family Laminin G-like module 0.046
Further Details:      
 
Domain Number 6 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 3.28e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1568-1727
Classification Level Classification E-value
Superfamily Fibronectin type III 6.45e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 8 Region: 2029-2197
Classification Level Classification E-value
Superfamily Fibronectin type III 2.21e-21
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 9 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-21
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 10 Region: 1385-1472
Classification Level Classification E-value
Superfamily Fibronectin type III 7.14e-20
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 11 Region: 1756-1926
Classification Level Classification E-value
Superfamily Fibronectin type III 7.55e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 12 Region: 1002-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 5.16e-19
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 1940-2024
Classification Level Classification E-value
Superfamily Fibronectin type III 2.76e-18
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 14 Region: 26-120,325-420
Classification Level Classification E-value
Superfamily Fibronectin type III 6.08e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 15 Region: 1472-1563
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-17
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 16 Region: 2209-2292
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000218
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022659   Gene: ENSECAG00000025065   Transcript: ENSECAT00000027086
Sequence length 3120
Comment pep:known chromosome:EquCab2:10:29778475:29883013:-1 gene:ENSECAG00000025065 transcript:ENSECAT00000027086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWARPADPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSDLIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPMKP
GEKKSGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDPRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLIKNTFMESAGARVG
FPKVAIIITDGKSQDEVEIPARELRSIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLIAMEVSSKYIKLGWSASPSP
VTGYKILLTPMTAGSRQHALSVGPQTTMLSVRDLSADTEYQISVSAMKGLTSSEPVSIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPRDLSFSEVTSYSFKTNWSPAGENVF
SYHITYKEATGDDEVTVVEPAASTSVVLNNLKPETLYFVNVTAEYEDGFSLPIAGEETTA
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIRYRPVAGGESKEVTTPANQRRRTLE
NLTPDTKYEVSVVPEYFSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSSMRLSWSGAPGK
VKRYLVTYTPVAGGEAQEVTVKGDTTSTVLSGLNEGTRYALSVTALYASGAGDALFGEGT
TLEERGSPQDLITKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVEAGEKNLPEDAIHT
VIENLQPETKYKISVFATYSSGEGEPLTGEATTELSQDSKTLKVDEETENTMRVTWKPAP
GKVINYRVVYRPRGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLVGQEMTTLSDTTVMPILSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHKDKQ
SLLEAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAVGIKNADEVELKMIATDPDDTHAYNVADFESLSRIVDDLTINLCNSVK
GPGDLEAPSNLVISERTHRSLRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLERSTV
LKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMRVQWQPVGGA
TGYSLSYEPVNATEPTKPKEMRVGPTVNDVQLTDLFPNTEYAVTVQAALHDLTSEPVTAR
KVTLPLPRPRDLKLRDVTHSTMNVLWEPVPGKVRKYIVRYKTPEEDVKEVEVDRSRTSTP
LRDLLSQTLYTVSVSAVYDEGESPAAAAQETTRTVPAPTNLRITEVSPESFRGTWDHGAS
DVSLYRITWAPLGSSDKMETIVNGDENTLVFENLNPNTLYEVSVTAIYPDESESDDLIGS
ERTPRLIPLTTQAPKSGPRNLQVYNATSYSLTVKWDSASGRVQKYRITYQPSTGEGNEQT
TTIGGRQNSVVLQKLKPDTPYTITVSSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
TLNVRWDHAEGNPRQYKLFYAPTAGGPEELASLPGNTNYAILRSLQPDTPYTVTVVPVYT
EGDGGRTSDTGRTLVRGLARNIQVYNPTPHSLDVRWDPAPGPVQQYRIVHSPEAGTRPPE
SMVVPGNTRMVRLEQLIPDTPYSVNIVALYSDGEGNPSPGQGRTLPRGGPRNLRVFGETT
NSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQSDTPYKITVIAV
YEDGDGGHLIGNGRTVGLLPPQNIHISDEWYTRFRVSWDPSPSPVLGYKIVYKPAGSNEP
MEVFVGEVTSYTLHNLDPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLKTDQIGWD
TFCVRWSPHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPDTDYGVTVFVQTPN
LEGPGVSVREHTTVKPTEAPTEPPTPPPPPTIPPAREVCKGAKADIVFLTDASWSIGDDN
FNKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRG
GNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFVV
GVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTS
PGFKMLEAYNLTEKSFASVQGVSLESGSFPSYSAYRLQKNAFVNQPTAEVHPNGLPPSYT
IILLFRLLPETPSDPFAIWQITDRDYKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTD
EVKTLFYGSFHKVHIVVTSNSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKS
ATFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGISGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGVKGDAGEPG
LPGRSGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPG
DHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSR
NQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGIGSPGPRG
LPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQG
YPEPYVPEGGAYLPEREPFVVPVEPERTADEYEDYGADQPADEQPPRARWRRARSRRPGP
Download sequence
Identical sequences F6QD89
XP_001914777.1.31192 ENSECAP00000022659 ENSECAP00000022659 9796.ENSECAP00000022659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]