SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022666 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022666
Domain Number 1 Region: 128-391
Classification Level Classification E-value
Superfamily vWA-like 6.67e-90
Family Trunk domain of Sec23/24 0.0000007
Further Details:      
 
Domain Number 2 Region: 8-66,408-516
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.92e-63
Family beta-sandwich domain of Sec23/24 0.00037
Further Details:      
 
Domain Number 3 Region: 620-760
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.45e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.0000063
Further Details:      
 
Domain Number 4 Region: 517-619
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.8e-46
Family Helical domain of Sec23/24 0.00000791
Further Details:      
 
Domain Number 5 Region: 49-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.7e-21
Family Zn-finger domain of Sec23/24 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022666   Gene: ENSECAG00000025087   Transcript: ENSECAT00000027094
Sequence length 764
Comment pep:known chromosome:EquCab2:22:6399786:6440493:-1 gene:ENSECAG00000025087 transcript:ENSECAT00000027094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLRERPDLPPVQYEPVL
CSRPTCKAILNPLCQVDYRAKLWACNFCFQRNQFPPAYTGISEVNQPAELMPQFSTIEYV
IQRGPQSPLIFLYVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSFVFRGTKDLTAKQIQDMLGLTTPAMPMQQARPQEHPFVSSRFLQPIQKIDMNLT
DLLGELQRDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGPGMV
VGDELKVPIRSWHDIEKDNARFMKKATKHYEMLANRAATNGHCIDIYACALDQTGLLEMK
CCANLTGGHMVMGDSFNTSLFKQTFQRIFSKDFNGNFRMAFGATLEVKTSRELKIAGAVG
PCVSLNVKGPCVSENELGVGGTSQWKICGLDPTSTLGIYFEVVNQHNAPIPQGGRGAIQF
VTQYQHSSTQRRIRVTTVARNWADAQSHLRHIEAAFDQEAAAVLMARLGVFRAESEEGPD
VLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPDESS
YYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRILLMDTFFQIVIYLG
ETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQARFPMPRYINTEHGGSQARFLLSK
VNPSQTHNNLYTWGQETGAPILTDDVSLQVFMDHLKKLAVSSAC
Download sequence
Identical sequences F6Q638
9796.ENSECAP00000022666 XP_003363993.1.31192 ENSECAP00000022666 ENSECAP00000022666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]