SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022868 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022868
Domain Number 1 Region: 283-413
Classification Level Classification E-value
Superfamily TIMP-like 4.55e-34
Family Netrin-like domain (NTR/C345C module) 0.01
Further Details:      
 
Domain Number 2 Region: 100-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 156-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 219-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022868   Gene: ENSECAG00000026819   Transcript: ENSECAT00000028951
Sequence length 418
Comment pep:known chromosome:EquCab2:11:51801123:51968333:1 gene:ENSECAG00000026819 transcript:ENSECAT00000028951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPPALHLTNRNEEEAVCPASHTDNGRFRADSFAFSTLDGRPSGHGFDNLPFLQGLGHAT
DIRVGFKRLTRFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCD
CRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSG
GVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKTCNQTTGQCPC
KDGVTGVTCNRCAKGYQQSRSPIAPCIKIPVAPPTTAATSVEEPEDCDSYCKASKGKLKI
NMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACK
CPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQRDTWARRLRKFQQREKKGKLKKA
Download sequence
Identical sequences F6QTJ6
ENSECAP00000022868 ENSECAP00000022868 9796.ENSECAP00000022868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]