SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022882 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022882
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily POZ domain 1.33e-27
Family BTB/POZ domain 0.0069
Further Details:      
 
Domain Number 2 Region: 309-398
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000992
Family Galactose-binding domain 0.043
Further Details:      
 
Domain Number 3 Region: 441-546
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000184
Family Galactose-binding domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022882   Gene: ENSECAG00000018393   Transcript: ENSECAT00000028936
Sequence length 612
Comment pep:known chromosome:EquCab2:20:37868367:38207520:-1 gene:ENSECAG00000018393 transcript:ENSECAT00000028936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQY
FRALLYGGMRESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKY
GFPELEDSTSEYLCTILNIQNVCMTFDVASLYSLPKLTCMCCMFMDRNAQEVLSSEGFLS
LSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNSKENHAEIMQAVRLPLMSLTELLNVVR
PSGLLSPDAILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDT
QNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDRDSRSYSYFIEVSMDELDW
IRVIDHSQYLCRSWQKLYFPARVCRYIRIVGTHNTVNKIFHIVAFECMFTNKTFTLEKGL
IVPMENVATIADCASVIEGVSRSRNALLNGDTKNYDWDSGYTCHQLGSGAIMVQLAQPYM
IGSIRLLLWDCDDRSYSYYVEVSTNQQQWTMVADRTKVSCKSWQSVTFERQPASFIRIVG
THNTANEVFHCVHFECPEQQSSQKEENSEEPGTGDTSLAGQQLDPHALQAPSGSSLPSSP
GSNSRSPSRQHQ
Download sequence
Identical sequences F6QSB5
9796.ENSECAP00000022882 ENSECAP00000022882 ENSECAP00000022882 XP_001495845.3.31192 XP_008521718.1.77740 XP_014686396.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]