SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000023041 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000023041
Domain Number 1 Region: 2-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000839
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000023041   Gene: ENSECAG00000026884   Transcript: ENSECAT00000028883
Sequence length 109
Comment pep:known chromosome:EquCab2:1:116473751:116523600:-1 gene:ENSECAG00000026884 transcript:ENSECAT00000028883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHEEPCGARHRSFCLNGGICYVIPTIPSPFCRCVENYTGARCEEIFLPSFSIRTKSDLFA
AFVALAILLGTFIIAAIYFLCRNGHLQRANVVQYDINLVETNSTSAHHS
Download sequence
Identical sequences F6ZNZ8
9796.ENSECAP00000023041 ENSECAP00000023041 ENSECAP00000023041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]