SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000076 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000076
Domain Number 1 Region: 46-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-39
Family SCAN domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 531-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 642-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.48e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 474-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 586-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 167-223
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 684-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 311-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000702
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 352-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000104
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000076   Gene: ENSECAG00000000117   Transcript: ENSECAT00000000103
Sequence length 743
Comment pep:known chromosome:EquCab2:25:16402663:16411672:1 gene:ENSECAG00000000117 transcript:ENSECAT00000000103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAVVLLNEMTAVSSDPQTLASSEQSKVLRMDTRGDREAVLRGDPADPESFRQRFRRFCY
SEVAGPRKALNQLWELCIRWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESS
EEVVTLIEDLTQALEAKEDPVSEDSVLSQEEPSEEDKMVSVLPNTESWESVTFKDVAVNF
SRGEWRKLEPFQKELYKEVLLENFRNLEFVGLPVSKLDLVSQLTWAELPRLLEKEISKGS
RSEATLDEIIERYLMGSDYGLMGESWKHGALEEDRSNKEYSQSAVTQKKTRGRGKKGEEF
DPERGPFGSNFKQTSDIIKHLRVYLRKKSRRYNECKKPFSFHSDLVLNRKEHGGEKSRKC
NEGRKVLSHSSSLTDHQKHQKIHFGDKTQKCTNCGVAFFQRSSLSKRKSSTCEKCRKNLC
QATASNKDEGTETEEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDSSS
LTPHHRTHSGEKPYKCDDCGKAFTLSAHLIKHQRVHTGEKPYKCKECGRPFSDSSSLIQH
QRIHTGEKPYTCNNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQRIH
TGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCNQCEKAFPTHSLLSRHQRIHTGVK
PYKCKECGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREYEC
NECEKTFKSNSGLIRHRGFHSGE
Download sequence
Identical sequences F7CP22
9796.ENSECAP00000000076 ENSECAP00000000076 ENSECAP00000000076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]