SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000304 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000304
Domain Number 1 Region: 147-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.72e-120
Family Transglutaminase core 0.000000011
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily E set domains 7.7e-46
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 607-704
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.41e-25
Family Transglutaminase, two C-terminal domains 0.00081
Further Details:      
 
Domain Number 4 Region: 486-605
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.37e-23
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000304   Gene: ENSECAG00000000416   Transcript: ENSECAT00000000390
Sequence length 709
Comment pep:known chromosome:EquCab2:1:145647731:145660224:1 gene:ENSECAG00000000416 transcript:ENSECAT00000000390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVAALELRSVDLQSSRNNKEHHTQEMGLKRLIVRRGQLFTLQLHFNRPFQFQTDHITFV
AETGPAPMELLGTRAIFSLTQARQGNVWSASDFTIDSDSLFVSLFTPANAVIGSYTLKIE
ISQGQGHSSTHPLGTFILLFNPWSAEDDVHLPSEALLREYILTDYGFVYKGQKRLITARP
WNYGQFEEDIIDICFEILNKSLYFLKNPSKDCSQRNDVVYVCRVVSAMINSNDDRGVLQG
NWGEDYSMGVSPLEWNGSVAILRQWSARGGQPVMYGQCWVFAAVMCTVMRCLGVPTRVVS
NFRSAHNADGNLTIDTYYNRNAEMLPNQKQDKIWNFHVWNECWMIRKDLPPGYNGWQVLD
PTPQQTSSGLFCCGPASVKAIKEGEVQLPYDTPFVYAEVNADEVIWLFGDGQAQEILAHN
TSSIGNEISTKMVGSDQRQNITSSYKYPEGSPEERSVFMKASQKMLGPGRASSPFLDLLG
SGDFQDQPAQLQLHLARMPEWGRDLLLKLHARRVADRAHPRAPIRLEVRFCAQALLHKGG
AREPLWRQTVHLNLDFGQEIEWPLLLPFNNYGNKLTDEKLIRVSGIAKVKETGRSMLVLK
DISLEPPHLSIKASERAEVGKALGVHITLTNNLTVALSNCVMVLEGSGLIDGQISNELGT
LLPGHTIQIQLDLYPIKAGPRQLQVLISSNEVKEIKGYQDIFVAAAGAS
Download sequence
Identical sequences F7D4E7
ENSECAP00000000304 9796.ENSECAP00000000304 ENSECAP00000000304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]