SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000419 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000419
Domain Number 1 Region: 30-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 147-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 3 Region: 258-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-33
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000419   Gene: ENSECAG00000000657   Transcript: ENSECAT00000000539
Sequence length 376
Comment pep:known chromosome:EquCab2:2:5341864:5353622:1 gene:ENSECAG00000000657 transcript:ENSECAT00000000539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAELGSYLLLAVALLGPGPRAQAMKGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLI
VVAEGSSVLLTFHTFDLEYHDTCDFDFLEIYNGASGDKGNLLGRFCGQVPPPPFTSSWHV
MSVIFHSDKHVASRRKFSLRGSFADVCGGVLTGLSGVLTSPEYPNNYPNNVECRWVIRAA
GPASIKLVFVDFQVEGNEDCTYDYVAVLGQPGPARGHHYCGSARPPTLVSLGRELQVVFK
SDFNIAGRGFKAYYFSGECQEVYTAVRGNFSSPQYPRSYPNNIRCHWTIRLPPGYQVKVF
FLDLELEGPNSLTRTCDFDHLMAFDGASEEAPMLGNWCGHHLPPPVTSSRNQLLLLLHTD
RSATHRGFSVAYIGGQ
Download sequence
Identical sequences F7CBK3
ENSECAP00000000419 9796.ENSECAP00000000419 ENSECAP00000000419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]