SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001080 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000001080
Domain Number - Region: 41-130
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00107
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001080   Gene: ENSECAG00000001594   Transcript: ENSECAT00000001408
Sequence length 173
Comment pep:known chromosome:EquCab2:2:54305193:54305711:1 gene:ENSECAG00000001594 transcript:ENSECAT00000001408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIQRNTFQATEQDKTPEKELNETEISDLLDKEFKQNIIRMLTDIGRRLDEHSELISKEL
ENIKKNQSEMKNTILEMKNSLEELNSRVEDAEEWISELDERLEEITQAEQKKEKRIRQNE
NSLRERWDNIKHTNIQIIGVPGDKRDKGAENLLEELIDENFPNLRKETDIQVQ
Download sequence
Identical sequences F6UXC3
ENSECAP00000001080 9796.ENSECAP00000001080 ENSECAP00000001080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]