SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001252 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001252
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily SAP domain 0.00000000659
Family SAP domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001252   Gene: ENSECAG00000000708   Transcript: ENSECAT00000001674
Sequence length 210
Comment pep:known chromosome:EquCab2:6:73541302:73582480:-1 gene:ENSECAG00000000708 transcript:ENSECAT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAETVELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEEHAEEEANEEDVLGDET
EEEEPKPIELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISSVPSKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKER
FGIVTSSAGTGTTEDTEAKKRKRAERFGIA
Download sequence
Identical sequences F6VDU3
ENSECAP00000001252 9796.ENSECAP00000001252 ENSECAP00000001252 NP_001296340.1.31192 XP_006093740.1.53796 XP_006179872.1.101512 XP_008146818.1.99482 XP_008532415.1.77740 XP_010962202.1.22495 XP_010975206.1.51371 XP_011374030.1.92234 XP_014403616.1.60319 XP_014712736.1.49734 XP_016021240.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]