SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001417 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001417
Domain Number 1 Region: 399-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 360-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000001417
Domain Number - Region: 524-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00022
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001417   Gene: ENSECAG00000001870   Transcript: ENSECAT00000001970
Sequence length 755
Comment pep:known chromosome:EquCab2:19:34658728:34694547:1 gene:ENSECAG00000001870 transcript:ENSECAT00000001970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSYEGEYAQPSTHSLLLRTANLPSYTPTVNMSDPLVLLDSDTGSLGDSSSSSSGSPLPL
PSVSQSHQASAHPLQSTPGAPIPLSSSPPPVPISLTASTPASKSIFQTTLPPSSSTLVLP
RARDTPVTSVWMSTMTSVTILPSSRTADPKNQSNSHHEQIITESELPSLESLPTEATEAV
TMRSTSGISMSPASTESSTEQTLPATSTSVAQTSPALTTTYLETSSPPVTTPSPASSTAA
LTAGPTVQTTTRKQLLTTSPEIPAPPISTEGSVTTERNQVRIDATIRLVPLTSTPTSAEE
LTTGVGITEEDTPTSHFLRTSPSPQTTDVSTAKMLPPKSTASTARSSTQSPTALSSPASA
NSCATNPCLHDGKCVVDPASRGYQCVCSPSWQGDDCSVDVNECLLNPCPPLATCNNTQGS
FTCKCPVGYQLEKEICNLVRTFVTDFKLKKTFLNTTVEKYSDLREAEKEITRTLNLCFST
LPGYTRSTVHASRESSAVAMSLQTTFSLASNVTLFDLADRMQKCVNSCRSSAEVCQLLGS
QKRLFRAGSLCKRKTPECDKETSICTDLDGVALCQCKSGYFQFNKMDHSCRACEDGYRLE
NETCMSCPFGLGGLNCGNPYQLITVVIAAAGGGLLLILGIALIVTCCRKNKNDISKLIFK
SGDFQMSPYAEYPKNPRSQEWGREAIEMHENGSTKNLLQMTDVYYSPTSVRNPELERNGL
YPAYTGLPGSRHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences F6W674
ENSECAP00000001417 ENSECAP00000001417 9796.ENSECAP00000001417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]