SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000001493 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000001493
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-38
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 595-773
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.46e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 193-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.52e-36
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 399-589
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 5 Region: 799-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000533
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000001493   Gene: ENSECAG00000002117   Transcript: ENSECAT00000002106
Sequence length 835
Comment pep:known chromosome:EquCab2:24:23798972:24109105:1 gene:ENSECAG00000002117 transcript:ENSECAT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGKSADYVNLALKD
GAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDY
TMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKI
YGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQ
ERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGR
SGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIR
DLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGT
GYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSAD
TLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTV
DDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNG
DIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSADGFILFNS
GDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVD
TKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLI
NDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCND
Download sequence
Identical sequences F6VXF8
ENSECAP00000001493 9796.ENSECAP00000001493 ENSECAP00000001493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]