SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000002290 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000002290
Domain Number 1 Region: 32-267
Classification Level Classification E-value
Superfamily L domain-like 2.55e-37
Family Ngr ectodomain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 279-359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000814
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000002290   Gene: ENSECAG00000003291   Transcript: ENSECAT00000003211
Sequence length 493
Comment pep:known chromosome:EquCab2:5:58613340:58615522:1 gene:ENSECAG00000003291 transcript:ENSECAT00000003211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPGDLRGLWLLLLSFFLLLFEVARAGRPLVSCPAACLCASNILSCSKQQLPNVPHSLP
SYTALLDLSHNNLSRLRAEWTPTRLTHLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSN
QLRTLDEFLFSELQALEVLLLYNNHIMAVDRSAFDDMAQLQKLYLSQNQISRFPLELVKE
GAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLHCDCELYQLFSHWQYRQ
LSSVMDFQEDLYCMSSKKLHNVFNLSFLNCSEYKERAWEAHLGDPLTIKCDTKQQGMTKV
WVTPNNERVLGEVANSTVTVSKDGSLHFEHVQVEDGGVYTCYAMGEAFNETLSVELKVYN
FTSHGHHDTLNTAYTTLVGCILSVVLVLIYLYLTPCRCWCRGVEKPSSHQGDSLSSSMLS
TTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPE
SVSSVFSDTPIVV
Download sequence
Identical sequences F6X0F6
ENSECAP00000002290 ENSECAP00000002290 9796.ENSECAP00000002290 XP_005610423.1.31192 XP_014690664.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]