SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003002 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003002
Domain Number 1 Region: 23-160
Classification Level Classification E-value
Superfamily L domain-like 2.04e-30
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 177-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000605
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003002   Gene: ENSECAG00000004443   Transcript: ENSECAT00000004350
Sequence length 337
Comment pep:known chromosome:EquCab2:1:119542591:119544940:-1 gene:ENSECAG00000004443 transcript:ENSECAT00000004350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLLVLWLVWALLGVAGACPEPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSA
NKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNLISSFPWSDLR
NLSALQLLKMNHNRLGSLPRDALGALPDLRSLRINDNRLRAAGAPPARPILCTAQPTPRF
LALTNGSLLVPLLSAKEAGVYTCRAHNELGANSTSVRVAVAAAGPPKHAPGAGGDPDGQT
PTSERKSTAKGRGNSGEEAEDQVSADPGLDEDAEQEDAGGDLQREESLAACSLVESQSKA
NQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYRQTAG
Download sequence
Identical sequences F6Q132
ENSECAP00000003002 ENSECAP00000003002 9796.ENSECAP00000003002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]