SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003216 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003216
Domain Number 1 Region: 371-479
Classification Level Classification E-value
Superfamily Anthrax protective antigen 1.14e-19
Family Anthrax protective antigen 0.012
Further Details:      
 
Domain Number 2 Region: 1830-1910
Classification Level Classification E-value
Superfamily E set domains 1.12e-16
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 3 Region: 3328-3516
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000153
Family Galacturonase 0.043
Further Details:      
 
Domain Number 4 Region: 2091-2178
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000224
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 2000-2087
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000496
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 6 Region: 1914-1995
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000588
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 7 Region: 1239-1318
Classification Level Classification E-value
Superfamily E set domains 0.000000000000108
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 8 Region: 1156-1235
Classification Level Classification E-value
Superfamily E set domains 0.000000000000677
Family E-set domains of sugar-utilizing enzymes 0.017
Further Details:      
 
Domain Number 9 Region: 1066-1143
Classification Level Classification E-value
Superfamily E set domains 0.0000000000115
Family E-set domains of sugar-utilizing enzymes 0.026
Further Details:      
 
Domain Number 10 Region: 271-361
Classification Level Classification E-value
Superfamily E set domains 0.0000000000131
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 11 Region: 1660-1743
Classification Level Classification E-value
Superfamily E set domains 0.0000000000726
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 12 Region: 1563-1639
Classification Level Classification E-value
Superfamily E set domains 0.0000000000784
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Domain Number 13 Region: 143-241
Classification Level Classification E-value
Superfamily E set domains 0.00000000171
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 14 Region: 1748-1820
Classification Level Classification E-value
Superfamily E set domains 0.00000000342
Family E-set domains of sugar-utilizing enzymes 0.02
Further Details:      
 
Domain Number 15 Region: 1331-1388
Classification Level Classification E-value
Superfamily E set domains 0.00000000687
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Domain Number 16 Region: 32-125
Classification Level Classification E-value
Superfamily E set domains 0.0000000586
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number 17 Region: 1406-1503
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000354
Family Plastocyanin/azurin-like 0.07
Further Details:      
 
Domain Number 18 Region: 2477-2683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000763
Family Chondroitinase B 0.053
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000003216
Domain Number - Region: 2218-2273
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.054
Family Zn-dependent arginine carboxypeptidase-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003216   Gene: ENSECAG00000000972   Transcript: ENSECAT00000004637
Sequence length 4252
Comment pep:known chromosome:EquCab2:9:53782588:53933100:1 gene:ENSECAG00000000972 transcript:ENSECAT00000004637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLWLLGTWGFWGLLLCAADPRTDGSKIIPKVTEIIPKYGSINGATRLTIKGEGFAQAN
QFNYGVDNAELGNSVQLVSSFRSISCDVEKDSSHSSHITCYTRAMPEDSYTVRVSVDGVP
ITENNTCKGHVNSWACSFNAKSFRTPTIRSITPLSGTPGTLITIQGRIFTDVYGSNTALS
SNGKNVRILRVYVGGMPCELLIPQSDNLYGLKLDHPNSDMGSMVCKTTGTYIGHHNVSFI
LDSDYGRSFPQKMAYFVSSLNKISMFQTYAVVTTISPSRGSIQGGTTLTISGRFFDQTDF
PVRVLVGGQACNVLNVTENSIHCKTPPKPDILRTVYPGGRGLKLEVWNNSRPVHLEEILE
YNEKTPGYMGASWVDSASYIWPMEQDSFVARFSGFLVAPDSDVYRFYIRGDDRYAIYFSQ
TGIPEDKVRIAYHSSNANNYFSSPTQRSDDVHLQKGKEYYVEILLQEYRLSAFVDVGLYQ
YRNVYTEQQTEDAINEEQLLQSRSTVVQEVQVITLENWETSNAINEVQKLTVTSPCVEAN
SCSLYQYRLIYNMEKTVLLPADASDFILQSALNDLWSIKPDTVQVIRTQNPQSYVYLVTF
VSTRGDFDLLGYEVFEGNNVTLDITEQTKGKPSLDTFTLKWEGINSKPLTPWSSEAEFQA
AVEEMVTAKCPPQIANFEEGFVVKYFRDYETDFNLKHINRGQKTAETDAYCGRSSLKNPA
VLFDSADVKPNRLPYGDILLFPYNQLCLAYKGFLANYIGLKFQYQDKSKITRSTERQFTY
NFAYGNNWTYTCIDLLDLIQTKYTGTSFSLQRISLQKASESQSFYVDIVYIGQTATISTW
DEMPKRRLPALANKGIFLKHFQVNQTKMNGSSMTNQYSVTMTSYNCSYNIPMMAVSFGEI
ITNETENESVYRGNNWPGESKIRIQRIQAASPPLSGSFDIQAYGHILKGLPAAVSAADLQ
FVLQSLEEVGQISVTREGTCAGYSWSIKWRSTCGKQNLLQVNDSNIIGEKANMTVMRIKE
GGLFRRRIIGDLLRTPSQQPQVEVYVNGIPAKCSGDCGFTWDLMTTPLVSATSPSQGSYE
ESTVLTISGSGFSPSSAVSVSVGPVGCSLLSVDENEIKCQILPGSAGRFQVAVSIADVGL
AQNVEGEVFHFIYQSQISHIWPASGSLAGGTLLTLSGFGFNENSKVLVGDETCIVIEGDL
NKITCRTPKRIEGTVDISVITNGFHATAKDAYSYNCLQTPVITDFSPKLRTVLGEVNLTI
KGYNFGNELTQNVEVSVGGKPCQVLHWNFTDIRCLLPELSPGKHNIYVEVRNWGFASTRD
KLNASIQYILEVTNMFPQRGSLYGGTEITVVGLGFSTIPNENTVLLGSFPCNVTSSSENV
IKCILHSTGNVFRITNNGEDSVHGLGYAWSPSVLNVSVGDTVTWRWQAQPFLRGIGYRVF
SVSSPGSVIYDGKGFTNGREKSTSGSFSYQFTSPGIHYYSSGYVDEAQSIFLQGVINVLP
AETRHIPLHLFVGSTEATYAQGGPENLHLASSAAGCLATEPLCGLNNTGVKNGERLLFEL
SSCFSPFITNISPSAGTVNELITITGRGFSSLACANKVTIGSYPCVVEESSNNSILCHID
PQNSMDVGMREIVTLTVYNLGTAINTLSDELDRRFVLLPNINMVLPNAGSTTGMTKVTIK
GSGFAVPSAGVEVLMGQFPCKVLSVSYTAIECETSPAPQQLMTVDLLIHGVPAKCQGNCS
FSYSESITPFITRIVPNSIEESVEVLIEGEGFGTILEDIAVFIGSQQFKAIDVNDNNITV
LVTPLPAGLHSLSVVVATKGLALGNLTVSSPAVASVTPTSGSIGGGTTLVITGNGFYPGN
TTVTVGDDPCQIISINSREVYCRTPAGTAGRVNVKIFVNAVAYPPLSFTYALEDTPLLRG
IVPSTGPPGTEIQITGSNFGVDILEVSVMINYIQCNVTMVSDSVLQCIVGEHAGGTFPVM
MHHKTKGSAVSTAVFEYPLTIQNIHPSQGSFGGGQTMTVTGTGFNPQNSIILVCGSECAV
DRLKSDSTTLLCKIPPNNGKGPEQVCEVSVVNGQDLSQSVTPFMYTNDMTPLITKISPKR
GSTAGGTRLTVVGSSFSENMQDVLITIAGAKCDVEYSNKTCIICMTNAHTPSGWAPVHVN
IRSIGMAKPDNANFLYVDAWSSNFSWGGDSPPEEGSLVVITKGQTILLDQNTPILKMLLI
QGGTLIFDDADIELQAENILITDGGILQIGTEASPFQHKAVITLHGHLRSPELPVYGAKT
LAVREGILDLHGLPIPVIWTRLAQTAKAGESTLILQEAVTWKPGDTIVIASTGHRHSQRE
NEKRTIASISPAGINITLTEPLNYTHLGITVTLPDGTLFEARAEVGILTRNILIRGSANV
EWNDKIPACPDGFDTGEFATQTCLQGKFGEEIGSDQFGGCIMFHAPIPGVNMVTGRIEYV
EIFHAGQAFRLGRYPIHWHLLGDLQFKSYVRGCAIHQAYNRAVTIHNTHHLLVERNIIYD
IKGGAFFIEDGIEHGNILQYNLAVFVQQSTSLLNDDVTPAAFWVTNPNNTIRHNAAAGGT
HFGFWYRMNNHPDGPSYDRNICQKRVPLGEFFNNTVHSQGWFGMWIFEEYFPMQTGSCTS
TVPIPARFNSLTTWNCQKGAEWVNGGALQFHNFVMVNNYEAGIETKRILAPFVGGWGETN
GAVIKNAKIVGHLDELGMGSAFCTTKGLVLPFSEGLTVSSIHFMNFDRPNCVALGVTSIT
GVCNDRCGGWSAKFVDIQYFRTPNKAGFRWEHEAVLIDVDGSLTGHKGHTVIPHSLLLDP
SHCNQEAEWSVGFPGAVCDASVSFHRLAFNKPSPVSLLEKDVVLSDSFGTSVVPFQKKRL
THMSGWMALIPNAKHINWYFKGVDQITNISYTSTFYGFKEEDYVIISHNFTQNPDMFNII
DMRNGSSNPLDWNTSKNGDWHLEANTSTLYYLVSGRNDLHQSQPISGTLDPDVKDVIINF
QAYCCVLQDCFPVHPSSRKPIPRKRPATYNLWSNDSFWQSSRENNYTVPHPGANVVIPEG
TWIVADTDIPPMERLIIWGVLELEDKHNVEAAESSHRKVVLNATYIFLQGGRLIGGWEDN
PFKGELQIVLRGNHSTPEWALPEGPNQGSKVLGVFGELDLHGIPRSIYKTKLSETAQAGS
KVLSLMDAVDWQVGEEIVITTTSYDFHQTETRSIIKILHDQKILILNDTLSYTHFAERYH
VPGTTQSYTLAADVGILSRNIKILGEDYPGWFKESFGARVLVSSFTENMMTFKGNARLSN
VEFYHSGQEGFRDSTDPRYAVTFLNLGQIQEHGSSYIRGCAFHNGFSPAIGVFGTDGLDI
DDNIIHFTVGEGIRIWGDANRVRGNLVALSVWPGTYQNRKDLSSTLWHAAIEVNRGTNTV
LQNNVVAGFGRAGFRIDGEPCSSQSNPMEKWFDNEAHGGLYGIYMNQDGLPGCSLIQGFT
IWTCWDYGIYFQTTESVQIYNVTLVDNGMAISSMIYMPAAVSHKISSKTVQIKSSLIVGS
SPEFNCSDVLTNDDPNIELSAAHRSSRPLSGGRSGICWPTFASAHNMAPRKPHAGIMSYN
AISGLLDISGNDSTFVGFKNVCSGETNVVFITNPLNEDLQHPIHVKNIQLVDTMEQSKIF
IHRPDVSKVNPSDCVDMVCDAKRKSFLRDMDGSFLGNSGSVIPQAEYEWNGNSQFGIGDY
RIPKVMLTFPNGSRIPVTEKAPYKGIIRDSTCKYIPEWQSYRCFGMEYAMMVIESLDSDT
ETRRLSPVAIMSNGYVDLINGPQDHGWCSGYTCQRRLSLFHSIVALNNSYEVYFTGTSPQ
NLRLMLLNVDHNKAVLVGIFFPTLQRLDVYVNNTLVCPKNTVWNSQQKHCELNRHLHTEH
FLPKLNSTVLGENYFDRTYQMLYLLVKGTIPVEIHTTAVIFVSFQLPAVTEDDFYSSPNL
VRNLALFLKIPSDKIRVSKIIRGERLRRKRSMALTVELEIGDPPLQFISNDTTGQMQLSE
LQEIAGSLGQAVISGKTSGILGFNISSMSITDPIPSPSDPGWIKVTAQPVERFAFPVHHV
AFVSSLWVITQPVAAQLGQPFSQQPSVKAVDSDGNCVSVGITSLTLKAILKDSNNNQISG
LGGNTTIPFSSCWANYTDLTLLRIGKNYKIEFILNNVVRVESMTFSLPAQSVSSGSSGSG
SSSSGSGSSKASTVGTAAQIMTTIISCLMGRVLLLEIFMAAILILNVNLGSN
Download sequence
Identical sequences F6QWH2
9796.ENSECAP00000003216 ENSECAP00000003216 ENSECAP00000003216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]