SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003326 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003326
Domain Number - Region: 36-131
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00018
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003326   Gene: ENSECAG00000004923   Transcript: ENSECAT00000004784
Sequence length 174
Comment pep:known chromosome:EquCab2:10:5139727:5140248:-1 gene:ENSECAG00000004923 transcript:ENSECAT00000004784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQRNTFQAREHYKTPQKELSETETSDFLIKEFKQNIMRMLTDMRRRMDEHSEHISKEL
EDIKKNQSEMKNTILEMRNSLEGLNSRVEEAEERISKLDERLEEITQAEQKREKRIRQNE
NSVRELWGNIKRANIRIIGVPEGEERVKGAENLFVEIIEENFPHLRKETDIQVQ
Download sequence
Identical sequences F6SXP5
9796.ENSECAP00000003326 ENSECAP00000003326 ENSECAP00000003326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]