SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003353 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003353
Domain Number 1 Region: 31-236
Classification Level Classification E-value
Superfamily L domain-like 1.22e-34
Family Ngr ectodomain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 285-391
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000355
Family I set domains 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003353   Gene: ENSECAG00000004865   Transcript: ENSECAT00000004818
Sequence length 510
Comment pep:known chromosome:EquCab2:16:37465334:37467005:1 gene:ENSECAG00000004865 transcript:ENSECAT00000004818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLVALGALLCMLRVGFGTLDSEGFLIPAPHNCPYKCVCAADLLSCAGLGLQDVPAALP
AAAADLDLSHNALQRLRPGWLAPLSRLRALRLGHNELDMLGRGVFTNASGLRLLDLSSNA
LKALGRHDLDGLGALEMLFLFNNRLAHLDEHAFRGLGALSRLYLGCNELASFSFDHLHGL
GATHLRTLDLSSNRLGRIPIPDLAALPAFLKNGLYLHNNPLPCDCRLYHLLQRWHQRGLT
AVSDFAHEYMCLAFKVPTSRVRFFEHSRIFENCSAALAWGLERPEEQLHVQVGRSLRLHC
NTSAPALRIAWVSPQHELLVAPGSRNGSIAVLADGSLAIGNVQPWHEGVFVCLATGPRLH
HNQTHEYNVSVHFPHPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCPGCRHCYHRTCCC
CCRRWPRTPSPLQELSAHSSVLSTTPPDAPSRKASVHKHVVFLEPGRRSLNGRVQLAIAE
DFDLYNPMGLRFKTGSESASSTGSEGLVMT
Download sequence
Identical sequences F6SQI1
ENSECAP00000003353 ENSECAP00000003353 9796.ENSECAP00000003353 XP_005600714.1.31192 XP_008522210.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]