SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005596 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005596
Domain Number 1 Region: 532-660
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-16
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 2 Region: 86-237
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000468
Family HspBP1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005596   Gene: ENSECAG00000006824   Transcript: ENSECAT00000007622
Sequence length 718
Comment pep:known chromosome:EquCab2:3:17666691:17670972:1 gene:ENSECAG00000006824 transcript:ENSECAT00000007622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRNVVKIAVQMRDAIPQLIQLDQAKPLAAVLKEVCDAWSLAHSERYALQFADGHRRY
ITENNRAEIKNGSILCLSTAPDLEAELLLGRLQSGSREVRREALQHLVLLAPDMTFAQEV
ISRDGLQRLGTIIEDGDDLGEVLALTLRTFLELMEHGVVSWETLSIPFVRKVVSYVNMNL
MDASVQPLALRLLESVTLSSPALGQLVKSEPLSRLVHLQVMNQQLQTKAMALLTALLQGA
SPAERKDMLDQLWQRNLRQFIYKNIIHSAAPLGDEMAHHLYVLQSLTLGLLEPRMRMPLD
PYSQEQREQLQALRQAAFEPEGESLGTGLSADRRRSLCAREFRKLGFSNSNPGQDLERVP
PGLLALDNMLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLTVLLCELLRVGEPCS
ETAQDFSPMFFGQDQSFHELFCVSIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLALK
PSSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRLLR
LCEGTLFRKISSRRRQDKLWFCCLSPNHKVLQYGDVEEGASPPPPESLPEQLPVADIRAL
LTGKDCPHVREKGSGKQNKDLYELAFSVSYDREEEEAYLNFIAPSKREFHLWTDGLSALL
GSPMGSEQTRQDLEQLLTMETKLRLLELENVPIPEKPPPIPPPPTNFNFCYDCSIAEP
Download sequence
Identical sequences F7CFX2
ENSECAP00000005596 9796.ENSECAP00000005596 ENSECAP00000005596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]