SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005908 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005908
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 4.67e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.48e-25
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005908   Gene: ENSECAG00000007922   Transcript: ENSECAT00000007962
Sequence length 427
Comment pep:known chromosome:EquCab2:11:10866361:10872980:-1 gene:ENSECAG00000007922 transcript:ENSECAT00000007962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFILSWLFFGCVFWLIALLHGDLDASKESK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences F7C3Q3
ENSECAP00000005908 XP_001498662.1.31192 XP_004432760.1.5094 XP_008520547.1.77740 XP_014594555.1.31192 XP_014594560.1.31192 XP_014594561.1.31192 XP_014695151.1.49734 XP_014695152.1.49734 XP_014695153.1.49734 XP_014695154.1.49734 XP_014695155.1.49734 ENSECAP00000005908 9796.ENSECAP00000005908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]