SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006330 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006330
Domain Number 1 Region: 882-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000012
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-31
Family Third domain of FERM 0.007
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-29
Family Second domain of FERM 0.00041
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006330   Gene: ENSECAG00000007687   Transcript: ENSECAT00000008449
Sequence length 1187
Comment pep:known chromosome:EquCab2:5:24463869:24565201:1 gene:ENSECAG00000007687 transcript:ENSECAT00000008449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNSVHLGIFFMGIF
VSNRIGRQAVIYRWNDTGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
ANEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVMHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPHGGYNNKLLGPSDQVNPKNNIVPSKPGASAISHTVSTP
ELANMQLQGPHNYNTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LNIPMARRNTLREQGPPEEVPGSHEVHPLPQYHHKKTFSDATMLIHSSESEEDEEEAPES
VPQIPVLHEKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRHDQVSLPPAMARARL
LRHGPAKAVSVSRADQLAVNGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREESRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNQHPPIVVHCSAGVGRTGVVILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences F6VJ48
XP_001488323.1.31192 XP_008513366.1.77740 XP_008513367.1.77740 ENSECAP00000006330 9796.ENSECAP00000006330 ENSECAP00000006330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]