SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006688 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006688
Domain Number 1 Region: 492-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000206
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000262
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 3 Region: 723-778
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000476
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 541-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000308
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 631-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000648
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 584-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000414
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 786-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000874
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006688
Domain Number - Region: 181-319
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.000321
Family gamma-carbonic anhydrase-like 0.08
Further Details:      
 
Domain Number - Region: 138-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00501
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006688   Gene: ENSECAG00000008525   Transcript: ENSECAT00000008872
Sequence length 885
Comment pep:known chromosome:EquCab2:22:49666420:49672271:-1 gene:ENSECAG00000008525 transcript:ENSECAT00000008872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPFCVGGGRRLPGSSKSGPGKDGSRSEVRLPVLHDPPKLGVPVVRGGQTVPSQAPLCF
DPGSQATDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCPGGAISERLTFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPTPKPGPVSRP
VTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVTKTVTVSRPVPVTKP
VTVSRPVPVTKAVPVTKPVTVNKPVPVTKPVPVTKPVTINKPLVTVTKPVPVTKLVTVSR
PIVVSKPVTVSRPIAISRHTTPCKMVLLTKSENKTPRAAGRSSGKKRAADSLDACPVLPK
QARPENGECGPSTASQGSAFQLSTDPSGGPLALGSRPLGGKEVPRAAGPGSPPEEGTERT
KHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRAHRTKKQEGPSPEDVRKKVPAPTS
TVSKEVPAPVAHPGPGGPEEQWQRAIHERGEAVCPTCNVVARKTLVGLKKHMEVCQKLQD
ALKCQHCRKQFKSKAGLNYHTMAEHSTKPSDAEASEGSEQEERERLRKVLKQMGRLRCPQ
EGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCIHCGKTYRSKAGHDYHMRSEHTAPPP
EEAEDKPAEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPE
TARLNYTRPGLPTVNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGD
HLVGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQDSLAPKKEEKSLA
GGKKRGRKPKERPPEEPAPKMPPRDDWPPGGRDKGARGSTARKVG
Download sequence
Identical sequences F6UBG7
ENSECAP00000006688 ENSECAP00000006688 9796.ENSECAP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]