SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006965 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006965
Domain Number 1 Region: 1065-1404
Classification Level Classification E-value
Superfamily NHL repeat 1.05e-23
Family NHL repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 1373-1393,1420-1562
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000916
Family All0351-like 0.062
Further Details:      
 
Domain Number 3 Region: 760-830
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000053
Family Pre-dockerin domain 0.069
Further Details:      
 
Domain Number 4 Region: 469-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000349
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006965
Domain Number - Region: 599-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 502-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000349
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 569-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000768
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 635-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00159
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 435-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00398
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 406-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0977
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006965   Gene: ENSECAG00000008038   Transcript: ENSECAT00000009190
Sequence length 2607
Comment pep:known chromosome:EquCab2:7:65696231:65919585:1 gene:ENSECAG00000008038 transcript:ENSECAT00000009190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHPGGLQNPSRLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEP
PAGGAQEPAHAQDNWLLNSNIPLETRNLGKQPFLGTLQDNLIEMDILSASRHDGAYSDGH
FLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFARPAFNLKKPSKYCNWKCAAL
SAIVISVTLVILLAYFVAMHLFGLNWHLQPLEGQMYEITEDTASSWPVPTDVSLYPSGGT
GLEIPDRKGKGATEGKPSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHL
KFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQRQSRGVVPPS
SHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISGTCHCF
LGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTSQCIDVACSNHGTCIMG
TCICNPGYKGENCEEVDCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHG
TFLPDTGLCSCDPSWTGHDCSIEICAADCGGHGVCVGGTCRCEDGWMGAACDQRACHPRC
AEHGTCRDGKCECSPGWNGEHCTIAHYLDRVVKEGCPGLCNGNGRCTLDLNGWHCVCQLG
WRGAGCDTSMETACGDSKDNDGDGLVDCMDPDCCLQPLCHVNPLCLGSPDPLDIIQETQV
PVSQQNLHSFYDRIKFLVGRDSTHVIPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFV
NNPLFGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETITMRHE
ENEIPSCDLSNFARPNPVVSPSALTSFASSCAEKGPIVPEIQALQEEISISGCKMRLSYL
SSRTPGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVY
NQKVFGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQSG
ILHKGNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALTCGSDGSLY
VGDFNYIRRIFPSGNVTNILELRNKDFRHSHSPAHKYYLTTDPMSGAVFLSDTNSRRVFK
IKSTMVVKDLVKNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKSGLIYFV
DGTMIRRIDQNGVISTLLGSNDLTSARPLSCDSVMDISQVRLEWPTDLAVNPMDNSLYVL
DNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIA
ETDEKKINRIRQVTTSGEISLVAGAPSVCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAV
CADGELYVADLGNIRIRFIRKNKPFLNTQNMYELSSPIDQELYLFDTSGKHLYTQSLPTG
DYLYNFTYTGDGDITLITDNNGNMVNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVT
TQGHELAMMTYHGNSGLLATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSV
HVQVETSSKDDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEP
HLLASTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFD
RVTRTEKIYDDHRKFTLRILYDHAGRPSLWSPSSRLNGVNVTYSPGGHIAGIQRGIMSER
MEYDQAGRITSRIFADGKTWSYTYLEKAGSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVA
RQTLETIRSVGYYRNIYQPPEGNASVIQDFTEDGHLLHTFHLGTGRRVIYKYGKLSKLAE
MLYDTTKVSFTYDETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFD
YNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHT
KHFDAYGRMKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQL
QTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKMDEDGFLR
QRGGDVFEYNSAGLLIKAYNRAGGWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTK
VTHLYNHSSSEITSLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQILY
TAYGEIYMDTNPNFQIIIGYHGGLYDPLTKLVHMGRRDYDVLAGRWTSPDHELWKHLSSS
NIMPFNLYMFKNNNPISNSQDIKCFMTDVNSWLLTFGFQLHNVIPGYPKPDMDAMEPSYE
LVHTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFDQLYGSTITSCQQAPETKKFASS
GSVFGKGVKFALKDGRVTTDIISVANEDGRRVAAILNNAHYLENLHFTIDGVDTHYFVKP
GPSEGDLAILGLSGGRRTLENGVNVTVSQINTMLNGRTRRYTDIQLQYGALCLNTRYGTT
LDEEKARVLELARQRAVRQAWAREQQRLREGEEGLRAWTEGEKQQALNTGRVQGYDGFFV
ISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences F6Q9I5
ENSECAP00000006965 9796.ENSECAP00000006965 ENSECAP00000006965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]