SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007417 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007417
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.24e-67
Family BAR domain 0.00053
Further Details:      
 
Domain Number 2 Region: 221-253,284-341
Classification Level Classification E-value
Superfamily SH3-domain 1.23e-17
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007417   Gene: ENSECAG00000009160   Transcript: ENSECAT00000009701
Sequence length 342
Comment pep:known chromosome:EquCab2:5:77240598:77277567:-1 gene:ENSECAG00000009160 transcript:ENSECAT00000009701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNARIEEFVYEKL
DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNF
LTPLRNFIEGDYKTISKERKLLQNKRLDLDAAKTRLKKAKAAETRASSEQELRITQSEFD
RQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYHCNN
NQTSVAPMPSASSNVIGSSALTSTSGLVIASPSNLVDLKECSGSRKARVLYDYDAANSSE
LSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYLELLN
Download sequence
Identical sequences F6YRF3
ENSECAP00000007417 ENSECAP00000007417 9796.ENSECAP00000007417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]