SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008350 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008350
Domain Number 1 Region: 166-289
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-25
Family Third domain of FERM 0.0025
Further Details:      
 
Domain Number 2 Region: 102-173
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-18
Family Second domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 8-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-17
Family First domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008350   Gene: ENSECAG00000010465   Transcript: ENSECAT00000010774
Sequence length 290
Comment pep:known chromosome:EquCab2:31:8320533:8334527:-1 gene:ENSECAG00000010465 transcript:ENSECAT00000010774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEMTPEHRDVLVLLPTREQLRLVVGVQATGRELFQQVCDLTSIREAHFFGLSVVRNNEYV
FMDLEQKLSKYFSKDWKRERHTVTGRSRAPFVAFLRVQYYVENGRLISDRRARHLYYCHL
KERVLRSECAHREEAYFLLAAYGLQADLGNHREAAHSGRYFEPHAYFPPWDKKGEQPTIV
LGLTLKGMHIYQEVNHALQLLYDFPWSHVGKLAFLGKKFEIRLDGLPSAKKLVYYTGCAS
RSRHLLQLLSSSHQLHLALQPLLRQLRELEEAEEKKCYRESYISDTLELE
Download sequence
Identical sequences F6QEG8
9796.ENSECAP00000008350 ENSECAP00000008350 ENSECAP00000008350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]