SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008369 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008369
Domain Number 1 Region: 17-414
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.15e-116
Family Amylase, catalytic domain 0.000000000000914
Further Details:      
 
Domain Number 2 Region: 420-510
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.45e-36
Family alpha-Amylases, C-terminal beta-sheet domain 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008369   Gene: ENSECAG00000010221   Transcript: ENSECAT00000010797
Sequence length 511
Comment pep:known chromosome:EquCab2:5:71646129:71654664:1 gene:ENSECAG00000010221 transcript:ENSECAT00000010797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLLLLSAIGFCWAQYDPHTQSGRTSIVHLFEWRWADIALECERYLAPKGFGGVQVSPP
NENIVVNNPPRPWWERYQPISYKLCTRSGSESEFRDMVTRCNNVGVRIYVDAVVNHMCGS
GGGAGTSSTCGSYYNAGSRDFPAVPYSGWDFNDGKCNTGSGEVENYNDIYQVRDCRVVGL
LDLALEKDYVRSTIAAYLNRLIDIGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTKWFPQG
SKPFIYQEVIDLGTEPIKGSEYFGNGRVTEFKYGAKLGTVLRRWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRIMSSYRWA
RNFQNGKDVNDWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPGGTYCDVISGDKINGNCTGI
KINVSSDGKAYFSISNTAEDPFIAIHAESKL
Download sequence
Identical sequences F6QDH8
ENSECAP00000008369 ENSECAP00000008369 9796.ENSECAP00000008369 XP_014595728.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]