SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009183 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000009183
Domain Number - Region: 158-234
Classification Level Classification E-value
Superfamily SEA domain 0.000275
Family SEA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009183   Gene: ENSECAG00000011113   Transcript: ENSECAT00000011712
Sequence length 910
Comment pep:known chromosome:EquCab2:20:45543362:45569354:-1 gene:ENSECAG00000011113 transcript:ENSECAT00000011712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRVFWLVSIFAIAESRGGFLERRDGIKTKRELTVNEKKPQGAVQEYELLLQVAYGDSK
EKRDLKSFLKLLNPPSLWSNGPMTIIRAKATTYCYNKNGFLRCACEDDYTWFPPSCLDPQ
KCYLHTAGSYQSCDCHLNNLTQSINFCERTKVWGTFKINETFTKDLLNSSSATHSRYTAG
IELQLKEAYKRIPGFESVRVTQFRDGSILAGYEVVGSSSTAELLSAIEQVAEEAKAGLHQ
LFPLEDDSFRVFGKVQCNSIGFGFGSTNDEYTLPCSSGYTGSITARCQPSGWQVLRETCV
LSQLEELKKNFSVIADNATEAAVSSVVRSLSVVIQQSQSTTAGNLASVVSILGNVSSLST
ARHFRVSNSTMEDIIRIADHILNSSSVTNWTVLLREEKHASSQLLETLENISMLVPPTAL
PLNFSREFINWKGIPGSEIQLEKGYNYQTEMLPQNISIPIRGHVLIGSDQFQRSLPETVI
SMASLTMGNILPITQNGNAQVNGPVISTVIQNYTINEIFLIFSKIESNLSQPRCVFWDFS
HLRWNNAGCHLVNETPDTVMCRCTHLTSFSMLMASFVPPAIIPVVKWITFVGLGISIGSL
ILCLIIEALFWKQVKKSQTSHTRHICMVNIALCLLIADVWFIVAATVDTTVNPSGVCIAA
VFFTHLFYLSLFFWMLMLGILLAYRIIFVFHHMAMPSMMAVGFCLGYGCPLIISVITIAV
TQPSDSYKSKDVCWLNWAEGSKPLLAFGVPALTIVAVNLVVVLLVLTKLWRPAVGERLSQ
DYKATIVRMGKSLLILTPLLGLTWGFGIGIMVDRQNPAWHVIFASLNAFQGFFILCFGIL
LDGKLRQLLFNKLSPLSSWKHASKQKSSDLSAKHKFAKPFNPLQHKGAYALSHTGESTSN
IMLTQFSAAE
Download sequence
Identical sequences F7B7A9
9796.ENSECAP00000009183 ENSECAP00000009183 ENSECAP00000009183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]