SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009403 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009403
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-30
Family C-type lectin domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 500-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 255-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000012
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 200-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000136
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 563-628
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000904
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 377-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 440-505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 640-706
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 9 Region: 322-394
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000688
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 695-760
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 11 Region: 160-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000927
Family EGF-type module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009403   Gene: ENSECAG00000010918   Transcript: ENSECAT00000011969
Sequence length 828
Comment pep:known chromosome:EquCab2:5:6026628:6072931:-1 gene:ENSECAG00000010918 transcript:ENSECAT00000011969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLKAIWSWRFHRVVFRSAQLLFFSALIYELVNQREVAAWTYHHSNKTYSWNDSREFC
QKYYTDLVAIQNKNEITYLNDVLPRHSSYYWIGIRKINNNWTWVGTKKTLTKEAENWADN
EPNNKGNNQDCVEIYIKSPRAPGKWNDEPCWKRKRALCYTASCQDTSCSKQGECIETIGN
YTCSCYPGFYGPECEYVTECGEFDLPQHVLMNCSHPLGNFSFNSECSFRCPEGFKLNGPS
KLECLASGMWTNYPPQCVAVQCPPLKTPERGNMTCVHAAKAFQLPSSCSFSCEEGFALVG
PDVVQCTASGVWTASAPVCKAVQCQRLEAPSQGTMDCVHPAAFAYGSSCKFECEAGYRVR
GWDTLNCTGPGQWTGPLPACEAIACEPLESPVHGSMDCSPSLMAFQYNTTCSFHCAEGFV
LRGADVVQCAELGQWTAPAPVCQALQCQDLAPNKAHVNCSHPFGAFRYQSTCSLTCDEGF
LLVGEHELQCLDTGHWSAPLPECRAITCTPLPSPRNGTMTCVRPLGDSSYKSTCQFTCDE
GFSLSGPERLDCTPSGHWTGSPPMCEAIKCPELFAPEWGSLDCSDTHGEFNVGSTCHFSC
NKGFRLEGPNNVECTASGRWTALPPTCEGEKSVPTPEVRCPALITPEQGTMSCRHHLGTF
GLNTTCYFGCKAGFTLTGDSAVRCRPSGQWTAVAPACRAVKCSKLHAIEPVAMNCSNPWG
NFSYESTCSFHCPDGQLLNGSASTACQESGQWSATMPNCQAGPLTIQEALTYMGGAVASA
IGLVMGGTLLVLLRKRFKQKDDGKSPLTAQSDLGTYGVFTNAAFDPSS
Download sequence
Identical sequences F7BMP6
9796.ENSECAP00000009403 ENSECAP00000009403 ENSECAP00000009403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]