SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009813 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009813
Domain Number 1 Region: 48-324
Classification Level Classification E-value
Superfamily L domain-like 4.28e-57
Family Ngr ectodomain-like 0.0029
Further Details:      
 
Domain Number 2 Region: 244-482
Classification Level Classification E-value
Superfamily L domain-like 8.5e-42
Family Ngr ectodomain-like 0.038
Further Details:      
 
Domain Number 3 Region: 543-844
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.78e-30
Family Rhodopsin-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009813   Gene: ENSECAG00000011949   Transcript: ENSECAT00000012423
Sequence length 907
Comment pep:known chromosome:EquCab2:Un0003:135864:249071:-1 gene:ENSECAG00000011949 transcript:ENSECAT00000012423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPSVGALLALPALLQLAAAGGSPGPGALLRGCPARCRCELDGRTLLRVDCADLGLAAP
PADLSAFTSFLDLSMNNISQLPPHPLRGLRFLEELRLAGNALTSVPKGAFAGLYSLKVLM
LQNNHLRQVPAEALQNLRSLQSLRLDANRIGRVPPGCFGGLRALRHLWLDDNALTEVPVR
AFRSLPALQAVTLALNSIRHVPDGAFAELSSLVVLHLHNNRIHSLGKKCFEGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRLIPEKAFVGNPSLVTLQFYDNPIQLVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTGSLEGLTLTGAQISSLPRTVCAQFPNLRVLDLS
YNLLEDLPSFSGCQKLQKIDLRRNGLCEIRVDTFQQLPALRSLNLAWNKIAIIHPNAFST
LPSLRKLDLSSNRLSSFPVTGLRGLTHLKLTGNHGLQSLISSENFPELKVIEMPYAYQCC
AFGVCESVYKISSQRNEGDNSSTGDLHRKDEGMLQVQDERDLEDFLLDLEEDLQALHSVQ
CSPSPGPFKLCEYLLGNWLIRIGVWTIAVLALTCNALVTSTVFGAPLHLSSVKLLIGLTA
MVNMLTGACSAVLAGVDAVTFGSFARHGAQWEQGVGCQVVGFLSVFASESSVFLLTLAAL
ERGFSVKCSAKFERKAPFSSLKAAILLCAMLALALASAPLLGGREYSTSPLCLPLPFGEP
GTTGYVVALVLLNSFCFLVMTVAYTRLYCGLERGGRGSAWDCCMVRHVALMLFTNCVLHC
PVAFLSFSSLLNLTFVSPEVTRFILLVIVPLPACLNPLLYILFNPHFKEDLGSLGEQTRL
WTRSKHTSLMSVNSDDAEKQSCNSTQALVTFPRARMAYDLPADSTVPPAHPGPESRHLSS
VAFVPCL
Download sequence
Identical sequences H9GZX1
ENSECAP00000009813 ENSECAP00000009813 XP_001495480.3.31192 9796.ENSECAP00000009813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]