SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000011756 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000011756
Domain Number 1 Region: 37-482
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.29e-98
Family Integrin alpha N-terminal domain 0.000000000599
Further Details:      
 
Domain Number 2 Region: 783-1013
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-64
Family Integrin domains 0.00000449
Further Details:      
 
Domain Number 3 Region: 483-641
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-47
Family Integrin domains 0.0000112
Further Details:      
 
Domain Number 4 Region: 642-776
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-36
Family Integrin domains 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000011756   Gene: ENSECAG00000012863   Transcript: ENSECAT00000014696
Sequence length 1061
Comment pep:known chromosome:EquCab2:29:19469919:19631554:1 gene:ENSECAG00000012863 transcript:ENSECAT00000014696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGARRGPRGRAQPLAPLWCFSAALGMLWSPASQAFNLDVDKFTVYSGPEGSYFGYAVD
FHIPTARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSVQCKQIPFDNTNNRKIKVN
GTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAYA
EYSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYSF
KDILRKLAREKQTEVAPASYDDSYLGYSVAAGEFTADSQQELVAGVPRGAQNFGYVSIIN
STDMTFIQNFTGEQMASYFGYTVAVSDVNNDGMDDVLIGAPLFMEREFESNPKEVGQVYL
YLQVSALVFRDPQVLTGTEVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGKDQRGKVLIY
NGNKDGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVYR
ARPVVTVDAQLLLHPMIINLENKTCQIPEATTSVACFSLRVCASAAGQSISNTIGLTVEV
QLDSLKQKGAVKRTLFLANHQPHLVFPLVIKRQNSFQCRDFVVYLRDETEFRDKLSPINI
SLNYSLDDSTFKDGLEVKPILDHYRENVVTEQAHILVDCGEDNMCIPDLKLSARPDKHQV
IIGDENHLMLTINARNEGEGAYEAELFVIIPEEADYVGIERSHKGLRPLSCEYKMENVTR
MVVCDLGNPMVAGTNYSLGLRFTVPRLEKTNVSINFDLQIKSSNKDNPDSNFVSLQINIT
AVAQVEIRGVSHPPQIVLPIHNWEPEEEPRKEEGVGPLVEHIYELHNIGPSSISDTLLEV
GWPFSARDEFLLYIFHIQTLGPLRCQTNPDINPQDIKPAAPAEDTPELSAFLRNSTIPHL
VRKRDVPGPELHRQSPAKILNCTNIECLQISCAVGRLDGGESAVVKVRSRLWAKTFLQRK
NDPYSLASLVSFEVKKMPYRDQPAKLPEGSMAIKTSVIWATPNVSFSIPLWVIILAILLG
LLVLAILTLALWKCGFFDRARPPQDDMNDREQLTNEKTPDA
Download sequence
Identical sequences F7BGF1
ENSECAP00000011756 9796.ENSECAP00000011756 ENSECAP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]