SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012151 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012151
Domain Number 1 Region: 91-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.81e-40
Family BAR domain 0.0061
Further Details:      
 
Domain Number 2 Region: 409-523
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.19e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.00031
Further Details:      
 
Domain Number 3 Region: 262-363
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-26
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 587-694
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-23
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 5 Region: 4-39
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000492
Family BAR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012151   Gene: ENSECAG00000014119   Transcript: ENSECAT00000015148
Sequence length 741
Comment pep:known chromosome:EquCab2:11:50343165:50354088:1 gene:ENSECAG00000014119 transcript:ENSECAT00000015148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLCIMLGPGRLGRARLFLPPGSPQ
MAFPCHVALLVCVSPLECKCHEGLLYPQDTSWDSHAVLLDATQHTLQQQIQTLVKEGLRG
FREARRDFWRGAESLEAALTHNAEVPRRRTQEAEEAGAALKTARAGYRGRALDYALQINV
IEDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLAQYRKDLGGQLHQLVLNSAREKRDME
QRHVLLKQKELGGEEPEPSLKEGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQK
KYKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSPSKSCLLQADSERLLQLWINAVQSSI
ATAFSQAHLDDSPRGSVQGSGHLAIGSAATMGCGGTTRGREPGGVGHVAAQVQSVDGNAQ
CCDCREPAPEWASINLGVTLCIQCSGITEFLGVHFSKVRSLTLDSWEPELVKLMCELGNV
VINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPPRGQ
PPVPPKPSIRPQPGSFRSKPEPPSDDLGSLHPGALLFRAAGHPPSLPTMADALAHGADVN
WVNGGQENATPLIQATAANSLLACEFLLQNGANVNQADNHGRGPLHHATILGHTGLACLF
LKRGADLGARDSEGRDPLTIAMEAANADIVTLLRLAKMREAEVAQGQAGDETYLDIFRDF
SLMASDDPEKLSRRSYDLHTL
Download sequence
Identical sequences F7C7P4
ENSECAP00000012151 9796.ENSECAP00000012151 ENSECAP00000012151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]