SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000012431 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000012431
Domain Number 1 Region: 649-844
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000414
Further Details:      
 
Domain Number 2 Region: 466-578
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-20
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 11-85
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000016
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 259-298
Classification Level Classification E-value
Superfamily WW domain 0.00000000994
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000012431   Gene: ENSECAG00000014289   Transcript: ENSECAT00000015465
Sequence length 846
Comment pep:known chromosome:EquCab2:29:5990422:6090272:1 gene:ENSECAG00000014289 transcript:ENSECAT00000015465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMADRSGKIVPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPVKQAVGLPNNSMKMIQSLHLQRSTENVNKLPELSSFGKPS
SSVHGTGLIRDANQNFGPNYNPGQTLNLSLDLTHNNGKFNSDSHSPKASGQNRTRLFGHF
PGPEFLDVEKSSFSQEQSCDSAGEGSERILQDSESGDELSSSSTEQIRATTPPNQGRPDS
PVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DTNISKGDSQSPGDQELLSSEENYHSICYSQSDSQCGSPPKGWSEELDERGHTLYTSDYT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDANDKESPTASKPCFPEYESSPSSPKHQDTASSPKGQEKYGLLNVTKITENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMAAKDKSSKK
NVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQTVETDETIEEETPDSPGIEKHDK
EKDQKDPKKLRSMKVSSIDSSEQKKTKKNLKKFLIRRPTLQAVREKGYIKDQVFGSNLAN
LCQRENGTVPKFVKLCIEHVEEYGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKW
EDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVTAVKDLIKQLPKPNQDTM
QILFRHLKRVVENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEI
SSIFGR
Download sequence
Identical sequences F7C673
ENSECAP00000012431 ENSECAP00000012431 9796.ENSECAP00000012431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]