SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013008 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013008
Domain Number 1 Region: 203-383
Classification Level Classification E-value
Superfamily MIR domain 2.09e-48
Family MIR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1062-1153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-18
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 642-791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000111
Family SPRY domain 0.068
Further Details:      
 
Domain Number 4 Region: 3903-3963
Classification Level Classification E-value
Superfamily EF-hand 0.0000000835
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number 5 Region: 417-532
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000327
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 6 Region: 1311-1438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000352
Family SPRY domain 0.019
Further Details:      
 
Domain Number 7 Region: 2041-2106
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000275
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 8 Region: 87-168
Classification Level Classification E-value
Superfamily MIR domain 0.00000968
Family MIR domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000013008
Domain Number - Region: 1784-1805,1874-2107,2477-2565
Classification Level Classification E-value
Superfamily ARM repeat 0.0193
Family MIF4G domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013008   Gene: ENSECAG00000013267   Transcript: ENSECAT00000016127
Sequence length 4851
Comment pep:known chromosome:EquCab2:1:153939326:154278140:1 gene:ENSECAG00000013267 transcript:ENSECAT00000016127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEVVLQCIANVHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLCVCNFVLEQSLSVR
ALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFDV
GLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVFSERYLHLSISNGNIQVDASF
MQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTIPSTDQNDSQHRRVFYEAGGAG
TRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLILQDRGKSDTKSTA
FSFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSVCFVQHVSSGLWVTYKAQDAKTSRLG
PLKRKVILHQEGHMDDGLTLQRCQQEESQAARIIRNTTALFSQFVSGNNRTTAPVTLPIE
EVLQTLQDLIAYFQPPEEEMQHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNIYNS
VAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSG
ILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKVLDVLCSLCLCNGVAVRANQN
LICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEP
THLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRIPRAVASINQHLLK
SDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVKVRFLMGGRHGE
FKFLPPTGYAPCYEALLPKEKMRLEPVKEYKRDAEGVRDLLGTTQFLSQASFIPCPIDTS
QVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEKN
YNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLP
PQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDSL
REAVRTFVGYGYNIEPSDQELADPAVEKVSIDKIRFFRVERSYAVRSGKWYFEFEVVTGG
DMRVGWARPGCRPDVELGADDQAFVFEGSRGQRWHQGSGYFGRTWQPGDVVGCMINLDDA
SMIFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGRMNLGMDASTFKFYTMCG
LQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVVRIDGTMDSPPCLKVTHKTFG
TQNSNANMIYCRLSMPVECHASFSHSPCLDSDAFQKRKQMQEILSHTTTQCYYTIRIFAG
QDPSCVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIVA
TSQRSSRSNVDLEIGCLVDLAMGMLSFSANGRELGTCYQVEPNTKVFPAVFLQPTSTALF
QFELGKLKNAMPLSAAIFKSEEKNPVPQCPPRLDIQTIQPVLWSRMPNSFLKVETERVSE
RHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMLFHYHTLRLYSAVCALGNSRVA
YALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLASAKERKQMMKNEYIIPITSST
GKIRLYPDESKRHGLPGVGLRTCLKPGFRFSTPCFVVTSEEHQKQSPEIPLEILKTKALS
MLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDDDSVRQILLLIDPSVFGE
HSGEMEEGAEKEEVTQVEEKAVEAGEKASKEAPVKGLLQTRLPESVKLQMCELLSYLCDC
ELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTREFRSPPQEQINML
LNFQLGENCPCPEEIREELYDFHEDLLIHCGVPLEEEEEEEEDTSWTGKLRALVYKIKGP
PKPEKELPTEEEERCPTTLKELISQTMIRWAQEDQIQDAELVRMMFNLLRRQYDSIGELL
QALRKTYTISQASVSDTINLLAALGQIRCLLSVRMGKEEELLMINGLGEIMNNKVFYQHP
NLMRVLGMHETVMEVMVNVLGAEKSQIAFPKMVASCCRFLCYFCRISRQNQKAMFEHLSY
LLENSSVGLASPSMRGFTPLDVAASSVMDNNELALGLEEPDLEKVVTYLAGCGLQSCPML
LAKGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRGEGG
NGLLAAMQGAIKISENPALDLPSQGYKREVSTEDAEDDEIVHMGNAIMSFYSALIDLLGR
CAPEMHLIQTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPSLNKDGSVSEPDMAANFC
PDHKAPMVLFLDRVYGIKDQTFLLHLLEVGFLPDLRASASLDTVSLSTTEAALALNRYLC
SAVLPLLTRCAPLFAGTEHYTSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICNHLR
PSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLPSGWGSYGLAVEEELHLT
EKLFWGIFDSLSHKKYDQDLFRMALPCLSAIAGALPPDYLDTRISATLEKQVSVDADGNF
DPKPINTVNFSLPEKLEYIVTKYAEHSHDKWACDKSMQRWKYGISLDENVKTHPLIRPFT
LTEKEKEIYRWPARESLKTMLAVGWTIERTKEGEALVQQRENEKLRSVSQASQGNSYSPA
PLDLSNVVLSRELQGMVEVVAENYHNIWAKKKKLELESKGGGSHPLLVPYDTLTAKEKFR
DREKAQDLFKFLQVNGIVVSRGMKDMELDASSMEKRFAYKFLKKILKYVDSAQEFIAHLE
AIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSSPLKPLSSSGYASHKEKEM
VASLFCKLAALVRHRISLFGNDSTTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFEN
AAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIFEHVAQHQFGVDLLL
GDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAAIPVAFLEPTLNRYNPLSV
FNTKTPRERSILGMPDTVEEMCPDVPQLEGLMKEINDLAESGARYTEMPHVIEVILPMLC
NYLSYWWERGPEHLPPSTGPWCTKVTSEHLSVTLGNILKIINNNLGIDEASWMKRIAVYA
QPIISKARPGLLRSHFLPTLEKLKKKAVKTVQEEEQLKADSKGDTQEAELLILDEFAVLC
RDLYAFYPMLIRYVDNNRSNWLKSPDAYSDQLFRMVAEIFILWCKSHNFKREEQNFVIQN
EINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYSIQTSLIVAALKKMLPIGL
NMCTPGDQELISLAKSRYSYKDTDEEVKEHLRNNLHLQEKSDDPAVKWQLNLYKDVLKSE
EPSNPEKTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNL
PHRSINLFLHGYQRFWIETEEYSFEEKLVQDLAKSPKVEEEEEEETEKQPDPLHQIILHF
SRNALTERSKLEDDPLYTSYSSMMAKSCQSGEEEEEEEDKEKTFEEKEMEKQKTLYQQAR
LHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNAGVQQKMLDYLKEKKDAGFF
QSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRERGEKILQNDEFTRDLFRFLQ
LLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESISDFYWYYSGKDIIDESGQH
NFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQ
IELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLK
DLTSSDTFKEYDPDGKGIISKKEFQKAMEGQKQYIQSEIDFLLSCAEADENDMFNYIDFV
DRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKSLLDPAESVLNYFEPYLGRIEIMGGAKK
IERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLAS
QISESDSADRPEEEEQAEEDSSYMLEIEGEEEDDRSFESVSAFAMACASVRRNVANFLKR
ATLKNLRKQYRKVKKMTVKELVKVFFSFFWTLFVGLFQLFFTILGGIFQILWNTVFGGGL
VEGAKNIRVTKILGDMPDPTQFGIHDDALEAERAEVTEPGIATELVYFVKGEKGDADIMS
DLFGYHSKKESGLKHGPEVGLGDLSEIIGKDEPPTLESAVQKKRKAQAAEMKAAHEAEGK
VESEKADMEDGEKEDTAKEEVQAEALWAEATKKKKRRCGQKVEKPEAFMANFFKGLEIYQ
TKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEETEDVANLWNSFNDEEEEE
AMVFFVLQESTGYMAPTLRALAIIHTIISLVCVVGYYCLKVPLVVFKREKEIARKLEFDG
LYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINKYGDLYGAERIAELLGLDK
SALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSVLGHYNN
FFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKS
EDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIV
ILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLA
NYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences F6VM10
ENSECAP00000013008 9796.ENSECAP00000013008 ENSECAP00000013008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]