SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013771 from Equus caballus 69_2

(show help)
Strong hits

Sequence:	ENSECAP00000013771
Domain Number 1	Region: 104-145
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	9.98e-17
Family	LIM domain	0.0068
Further Details:

Domain Number 2	Region: 37-83
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000416
Family	LIM domain	0.00072
Further Details:

Domain Number 3	Region: 146-188
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000000235
Family	LIM domain	0.0011
Further Details:

Domain Number 4	Region: 9-35
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000155
Family	LIM domain	0.0065
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSECAP00000013771 Gene: ENSECAG00000016087 Transcript: ENSECAT00000017004
Sequence length	194
Comment	pep:known chromosome:EquCab2:7:87104375:87122210:-1 gene:ENSECAG00000016087 transcript:ENSECAT00000017004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSATTSNPSKFTAKFGESEKC PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG IGFGGLTHQVEKKE
Download sequence
Identical sequences	A0A0D9QYH0 A0A2K5IMU1 A0A2K5YI66 A0A2K6C5P4 A0A2K6L0R0 A0A2K6NPN6 F6T7Q2 F6V0P8 G7PQK4 ENSECAP00000013771 ENSECAP00000013771 ENSMMUP00000025138 XP_001095430.1.72884 XP_001505029.1.31192 XP_005578472.1.63531 XP_005578473.1.63531 XP_008002679.1.81039 XP_008528745.1.77740 XP_010386428.1.97406 XP_011748538.1.29376 XP_011792871.1.43180 XP_011832662.1.47321 XP_011832665.1.47321 XP_011943961.1.92194 XP_011943962.1.92194 XP_011943963.1.92194 XP_014970137.1.72884 XP_017713712.1.44346 ENSMMUP00000025138 ENSPANP00000002308 9544.ENSMMUP00000025138 9796.ENSECAP00000013771

SEARCH