SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000013922 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000013922
Domain Number 1 Region: 594-652
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000213
Family BSTI 0.045
Further Details:      
 
Domain Number 2 Region: 1367-1426
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000556
Family ATI-like 0.014
Further Details:      
 
Domain Number 3 Region: 986-1037
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000441
Family BSTI 0.043
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000013922
Domain Number - Region: 254-309
Classification Level Classification E-value
Superfamily FnI-like domain 0.00492
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number - Region: 2083-2124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000013922   Gene: ENSECAG00000016222   Transcript: ENSECAT00000017171
Sequence length 2153
Comment pep:known chromosome:EquCab2:7:28626950:28692894:1 gene:ENSECAG00000016222 transcript:ENSECAT00000017171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSLLRIWVSFIFALVRHQAHPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPIFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPV
ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPDIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTIKCRCLDFNNEIYCQEASCS
PYEVCEPKGKFFSCSPVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF
FSVEAKNEHRGGSAVSWVKELSVEVNGYKILIPKGSYGKVKVNDLVTSLPITLDLGAVKI
YQSGMSTAVETDFGLLVTFDGQHYASISIPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHADWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV
VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRIQTGCVSTVQCPSF
SHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNEGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDIYCFNKTCRGGEVCAVEEGYRGCFPKRETVCLLSQNQV
LHTFDGAAYAFPSEFSYTLLRTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKI
GGIWASEVKLNGQEVELPFFHPLGRLEIYRNKNSTTVESKGIVTVQYTDIGLLYIRLSTA
YFNCTGGLCGFFNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARY
ASACKNADVEVGPWRTYDFCPLDARRQHFEECVTCVETCETLTLGPICVDTCSEGCQCDE
GYALQGSQCVTRSECGCNFEGHQLATNETFWVDLDCQIFCYCNGTDNSVHCETVPCKDDE
YCMEDGGLYHCQARTDASCIVSGYGHYLTFDGYPFDFQTSCPFILCTTGNRPSSDAFPKF
IVTAKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNNERLYLPLKLGHGKINIF
SFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNSNPDDDLEMPMGLLAS
SISEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCGLIPNQNAGFAKCHSKVNPA
FFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGIAVTGWRNYTSCSVTCPPNSHYESC
VSVCQPRCAAIRLKSDCNHYCVEGCQCDPGYVLNGKSCILPHNCGCYSDGKYYEPKQLFW
NSDCTRRCRCFRRNLIQCDPRQCKSDEECALRGVRGCFSTKTSYCLAAGGGVFRTFDGAF
LRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIISPVYFYINEEQILINDRNTV
KVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCGLC
GNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKRRLAPSCNELQFSQYAAMCDNVHI
QKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHMKFQLCGSLAAYGESCR
SFGILSTEWIEKENCSGVVEDPCVGAVCPNRTCELENGGELCGCIEPPPYGNNSYDIIDA
EVTCKPSQMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNIVQ
SNATHIMYKNTVWIESANNTGNIITRDRTISVDFSCAYELDIKISLDAVVKPMLSVINLT
VPTQEGSFTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADATHLILTLNKCYA
TPSRDSNDKLRYFIIEEGCQNIKDNTIGIEENGVSLTCRFHVTVFKFIGDYDEVHLHCAV
SLCDSEKYSCKVICPQNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDSGGCEQICTSRV
DGPLCSCVTGTLQEDGKSCRASNSSIELQVWTLLLIMTQISLWHFVYKSGTTS
Download sequence
Identical sequences F6W8I4
9796.ENSECAP00000013922 ENSECAP00000013922 ENSECAP00000013922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]