SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014351 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014351
Domain Number 1 Region: 621-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.76e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000976
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-37
Family Second domain of FERM 0.0000698
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.1e-23
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 7.45e-21
Family PDZ domain 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014351   Gene: ENSECAG00000016313   Transcript: ENSECAT00000017650
Sequence length 926
Comment pep:known chromosome:EquCab2:18:11164344:11368904:-1 gene:ENSECAG00000016313 transcript:ENSECAT00000017650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAVQSELGDYNQSENLPGYLSDYSFIPNQ
PQDFEKEVTKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHVVHASPSEVFVNHRSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWNQIHY
SHSQQDLENHINETFDVPSSPEKSTPNGGVPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGQDIAEHTHDQVVLFIKASCERDSGELVLL
VRPNAVYDVVEEKLENEPDFQYIPEKTPLDNVHQDDHSLRESMSQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTACIFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRSK
RAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTSSSNK
Download sequence
Identical sequences F6YHQ8
9796.ENSECAP00000014351 ENSECAP00000014351 XP_001492570.1.31192 ENSECAP00000014351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]