SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014454 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014454
Domain Number 1 Region: 423-654
Classification Level Classification E-value
Superfamily GFP-like 1.05e-92
Family Domain G2 of nidogen-1 0.00000000136
Further Details:      
 
Domain Number 2 Region: 937-1173
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-46
Family YWTD domain 0.000000000949
Further Details:      
 
Domain Number 3 Region: 805-913
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-25
Family Thyroglobulin type-1 domain 0.00052
Further Details:      
 
Domain Number 4 Region: 760-835,871-884,1194-1238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-16
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 5 Region: 379-420,665-746
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000385
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014454   Gene: ENSECAG00000016615   Transcript: ENSECAT00000017772
Sequence length 1241
Comment pep:known chromosome:EquCab2:1:75400433:75475652:1 gene:ENSECAG00000016615 transcript:ENSECAT00000017772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAMRRSGPAWTRALLLQLLLAGPGGCLSRELFPFGPGQGDLELEGDDRISPALELKGA
LRFFDKSDIHSVYVTTNGIIATSEPPAKESHPGLFPPTFGAVAPFLADLDTTDGLGKVYY
REDLSPSVTQLAAECVQRGFPEVSFQPSSVVVVTWDSVAPYQGPSKDPAQEGKRNTFQAV
LASSDSSSYAIFLYPEDGLQFSTTFSKKEEDQVPALVAFSGLVGLLWKSDGAYNIFANDR
ESIGNLAKSSNSGQQGVWVFEIGSPATASGVISSDVNLGLDDGTEYDDEDYDSVTHLGLE
DVGTTSFPYETPRRGDTGTHNRPSVLSPRHLATERPPGPPTERTRSFQLPVERFPQQHPQ
VIDVDEVEETGVVFSYNTHSRQTCANNRHQCSVHAECRDFTTGFCCSCVAGYTGNGRQCV
AEGSPQRVNGKVKGRIFVGNSQVPIVFENTDLHSYVVMNHGRSYTAISTIPETVGYSLLP
LAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGKLVIKQQFSGIDEHGHL
TIDTELEGHVPQIPFGSSVHIEPYTELYHYSRGVITSSSTREYTVTEPERDGAAPSHVHT
YQWRQTITFQECTHDDSQLALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPVRDGSPD
ALQNPCYIGTHGCDTNAACRPGPGTQFTCECSIGFRGDGRTCSDIDECLEQPSVCGSHAI
CNNHPGTFRCECVEGHRFSEEGTCVAVVDERPINYCASGLHDCDIPQRAQCIYTGGSSYT
CSCLPGFSGDGRACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFHCVPGEAEK
TRCQHEREHILGAAGAADPQRPRPPGLFVPECDEHGHYTPTQCHGSTGYCWCVDRDGREV
EGTRTRPGMRPPCLSTVAPPIDHGPSVPTSVIPLPPGTHLLFAQTGKIEHLPLEGSTMKK
TEAKALLHAPDKVIIGLAFDCVDKMVYWTDISEPSIGRASLHGGEPTTIIRQDLGSPEGI
ALDHLGRNIFWTDSYLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYWTDWNRD
SPKIETSYMDGTNRRILVQDDLGLPNGLTFDAYSSQLCWVDAGTNRAECLSPSQPSRRKV
LEGLQYPFAVTSYGKNLYYTDWKTNSVVAVDLAISKETDTFHPQKQTRLYGVTTALSQCP
QGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences F6XH19
9796.ENSECAP00000014454 ENSECAP00000014454 ENSECAP00000014454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]