SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000014496 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000014496
Domain Number 1 Region: 116-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-27
Family MAM domain 0.016
Further Details:      
 
Domain Number 2 Region: 842-902
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000916
Family BSTI 0.024
Further Details:      
 
Domain Number 3 Region: 1-110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000554
Family MAM domain 0.0084
Further Details:      
 
Domain Number 4 Region: 1231-1291
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000015
Family BSTI 0.066
Further Details:      
 
Domain Number 5 Region: 2030-2089
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000131
Family BSTI 0.046
Further Details:      
 
Domain Number 6 Region: 464-518
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000162
Family ATI-like 0.038
Further Details:      
 
Domain Number 7 Region: 2145-2183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000172
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000014496   Gene: ENSECAG00000016429   Transcript: ENSECAT00000017819
Sequence length 2240
Comment pep:known chromosome:EquCab2:13:8732910:8760977:1 gene:ENSECAG00000016429 transcript:ENSECAT00000017819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFYMLLDPKDAKPRQKCVLLSPLSRSSGCLTLSFHYTLYGQSPGAALMVYASVLGSIRKH
TLFSGQPRPYWQSVSVSYTGQGQIQFAVVGVFGVVPEPAVAVDAIVIAPCGESFPECDFE
DDARPFCNWAQASGNGGHWARGSKNQSLQGPGPFGASLNGESHYIYLQPGKFSQAGQSFR
LMSRPFCTPGAICVELSYHMYGFGEGAKLRLLLESPAGSSPTSLWHCVGSQSPDWLNTSI
TIPSGRQQPIQLILEAIRGTNSAFVMAVGFIFINHGTCRGPISYVRPAPTVLPSKSPVPL
TGPSETPVFTGKHMATTEKPTVPSEISTIPTEKATVPTEKPTVATEKPIVPTEKPTVPTE
KPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPTVPTEKPHL
PPQKGPSPTLVPTEPTVLAMPLGAPSMPMTAVTLASTEGPRPTPASCPPNAHYESCACPA
SCQSPKPTCEFVCQPGCVCNPGFLFNDSRCISASSCSCMYNNNYYKPGVEWFSPNCTERC
RCWPGSRMECELSQCATHTVCQLKNGEYGCHPYGTATCFVYGDPHYLTFDGRHFGFMGKC
TYILAQARGNLTEPFFRVTAKNEERGQEGVSCLSKVYVTLPDTTITLLKGRRTLVGGQQV
TLPAIPSKGVFLAPSGRFVELQTAFGLRVRWDGDQQLFISVSSTYSGKLCGLCGNYDGDS
SNDNQEPDGSPERDDEELGHSWQMVEDEDVECQKNQATPPSCTSALLNGLSGPEFCGRLA
DSHGTFEACLPHLGASPFFESCMFDLCNFQGLQLMLCAHMAALTETCQDAGYVVKPWRGP
QFCPLACPPNSHYTLCAKVCPDTCHSGFSGMSCQDRCVEGCECNSGFVLSGLQCVPRSQC
GCLTPGAGYFKIGQQWFKPGCRQLCICEGNNRIRCELWRCQPQEVCSLQGGIYGCHAQGT
GTCTVSGDPHYLTFDGALHHFMGTCTYVLTQLCLVRSLENTFVVSATNEFRSGNLEASYV
KAVHVQVFNLRISLIKGHKVVLDGRRVALPLWPAHGRVSIRPSGSFVLLYTDFGLQVRYD
GNHLVEVTVPSTYAGRLCGLCGNYNNNSLDDILSPHKRPVGSSVQLGISWKSNEYSEPGC
FVGGAGGQPSRCQEKEAADTWNKNCDILMNPVGPFSQCHEVVPPHSSFASCVYGQCGSKG
DPLTLCRSLQAYASLCARAGRAPDWRNSTFCPLKCPSGSSYSRCANPCPVTCFSLTTPKD
CPAALPCAEGCECQKGHVLSGVSCVPLSQCGCTDQWGSYHPVGESWFTDNTCSKLCTCST
HNISCLQTACKPSQMCWPLDGLMRCRAADMGVCRILEESNYVSFDGAYHALGSTCTYVLV
KVCHSTMDLPFFKITGKNGEREGQTSTFYLRQLNVNIFGFLVTLQQGHRVLINGTQVSLP
LTSQIRGVSITARGAYTVLSINIGVQVKFDGNGFLEIKLPRAYYEKVCGMCGNFNGEEED
ELMMPSDELAENDTQFVDSWRDKESDPKCQQDEQTVTPTEQQEKPITDCRPADLVTAQKE
CEAAFHAPAWAECATRVIVKPLLLGCTYKLCEFGGLNHLLCEALQAFGAACEAQGLKPPI
WRNSSFCRECPLWSPQNCSQALLPSYFKDAQCEVPSHPDPILYLCTCKQVGIVGSRTVCL
WLEEFTFSPAPYESVLKNKKKLTSLCCGLFLCVDVSIGSRWLLADSRLPCGTGKTIARWP
FSAESEQCSVFGDPHYRTFDGLSYRFQGRMTYTLVKTVDVLPDGVEPLVVEGRNKMIPPF
TSIFLHEILVMVYGYTIQLQTNLELVVNNQKMAIPYKVNEHLRVTMRSHRLYLITNFELV
VSFDGRNNAVISLPSMYEGLVRGLCGNYDKNRRNEFMLPNGTLTQNLNTFGNSWEVKIKE
DLARVSRAIPEEEDGEEELGFQVTECSPEQLELRNSTQACGVLVDPQGPFATCHQTVAPD
PFHEHCVFDLCAAWDPRQREELRCQVLSGYAIICQEAGAALAGWRDHTHCALVCPANTVY
QSCMTPCPASCANLAAPGDCEGPCVEGCASLPGYVYSGAWSLPLAHCGCTHNGIYYQRGD
RFVTEDCSQRCICASSGVLLCEPFSCRAGEICTLGNFTRGCFRESPCLRNPCQNDGRCQE
QGPHFTCECELGYGGDLCTEPWDVPPPEKPEVFALVAILLGMLVPVIVVVPALTRECVSR
KRRRRRNETQPGGETSPGRE
Download sequence
Identical sequences F6XBE7
ENSECAP00000014496 9796.ENSECAP00000014496 ENSECAP00000014496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]