SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015091 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015091
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.43e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 294-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015091
Domain Number - Region: 138-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0166
Family Classic zinc finger, C2H2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015091   Gene: ENSECAG00000017529   Transcript: ENSECAT00000018497
Sequence length 349
Comment pep:known chromosome:EquCab2:10:8204536:8217238:1 gene:ENSECAG00000017529 transcript:ENSECAT00000018497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHWLVTFRDVAIDFSQEEWECLDPAQRDLYREVMLENYSNLVSLAGCSVPKPDVFSLLE
QGKEPWMVSRKQALGGFCADNKFLCGTKKSSPEKGTYETESLQWNYMRKPVSHNLKHHDL
GDNMECKDKFEGQQRSQEGLYMHMKITCEEKPTQSHSTSLTLHQINPTKEKLYKRKEACG
KAFIRGSQLTEHQRVHTGEKPYECEKCGKAFSYCSQYTLHQRIHSGEKPYECKECGKAFI
LGSQLTYHERIHSGEKPYECKECGKAFILGSHLTYHQRVHTGEKPYRCKECGKAFLCASQ
LNEHQRIHTGEKPYECKECGKAFFRGSQLTYHLRVHTGERPYKCKACGK
Download sequence
Identical sequences F6SZF6
ENSECAP00000015091 9796.ENSECAP00000015091 ENSECAP00000015091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]