SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015799 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015799
Domain Number 1 Region: 92-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000033
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015799
Domain Number - Region: 417-667
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00238
Family Bacteriorhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015799   Gene: ENSECAG00000018058   Transcript: ENSECAT00000019310
Sequence length 670
Comment pep:known chromosome:EquCab2:3:36433574:36464368:-1 gene:ENSECAG00000018058 transcript:ENSECAT00000019310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPWCPQNSTCINATACRCRPGFSSWSGEIITNPADSCDDINECEPPLAVSCGKFVDCQN
VDGSYHCTCAPGYGLVSGATTFRNEIENTSQYVDECSSGQHRCHNSTVCVNTMGSYRCCC
RPGWTPLPGFRDNQNTTVCEEMSFPTWTPPPGIQSQSLSGFFEGVQDLRRHFKPASAQNT
VRDLIQSVDELLKAPGDLETLALPDRHHTVTHLLSGLEEILRTLAKAMPGASFTYQSSEG
TELSLVIQEQGHGNVTLGQSHARMVLDWAMAAGAGPVCLSAGPAVAGILSSPNMQKPLAN
ASLELDPERQAELEETHDSPLRGIQWRLLSAVKSVLLSNTNTTKLDPKVTVIFSHPSARA
QDPRGELICAFWKGAGHGGGHWATTGCRRLGSRNGNTTCLGLPGSMASLVNPEDVEDPVL
DVITYVGLSLSLLCLLLAALTFLLCRAIQNTSTSLHLQLSLCLFLAHLLFLTAIDRTEIK
VLCALIAGALHYLYLASFTWMLLEGLHLFLTARNLTVVNYSSWLMFPVGYGVPAVIVAIS
AASRPHLYGTSTRCWLRSESGFIWGFLGPVCAICSVNLAFFLMTLWMLKSRLSSLNSDVS
TLQDTRMLTFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLR
QQVREQYGKW
Download sequence
Identical sequences F6Q394
ENSECAP00000015799 ENSECAP00000015799 9796.ENSECAP00000015799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]