SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015851 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015851
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 1.54e-44
Family ML domain 0.00000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015851   Gene: ENSECAG00000018345   Transcript: ENSECAT00000019372
Sequence length 149
Comment pep:known chromosome:EquCab2:24:20036109:20043880:-1 gene:ENSECAG00000018345 transcript:ENSECAT00000019372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLDAAFLLLALGASALANPVHFKDCGSQVGVVKEVNVNPCSTQPCQLHKGQSYSVNVT
FTSNTQSQSSKAVVHGIVLGVPVPFPIPEPDGCKSGISCPIQKDKSYNYVNKLPVKSEYP
SIKLVVKWELQDDKGQSLFCWEIPVQIEG
Download sequence
Identical sequences F7CIW5
ENSECAP00000015851 9796.ENSECAP00000015851 XP_001490688.1.31192 XP_005605383.1.31192 XP_005605384.1.31192 ENSECAP00000015851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]